Details for Capsella Locus Carubv10014155m

Position : scaf_3 ( 5`- 806860 .. 810290 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014155m

Protein [Map View]
MLTLLFVSLGVILLIGLLVKFALADGDFTLISKRHVKREAIEGKVVWITGASRGIGEILAKQFASLDAKLILSARNKAEL
ERVKSELKGKYAPEDVKVLPLDLASGEESLKHVVEQAVSLFPGAGVDYLVHNAAYERPKSKASDATEETLKTTFDVNVFG
TITLTKLVAPYMLNQGGGHFVVISSAAGKVPSPGQAIYSASKHALNGYFHSLRSEFCQKGIKVTVVCPGPIETLNGTGTS
TSEDKKSPEKRVSSERCAELTIIAASHNLKEAWISCQPVLLVMYLVQYMPSLGFWLMDKVGGNRVEVAEKKGNTYSWNLL
FRKKTKTKDI*

DNA
ATGCTGACTCTACTCTTCGTCTCCCTCGGAGTCATCCTTCTTATCGGTCTGCTCGTCAAATTCGCACTCGCCGATGGAGA
TTTCACCCTGATTTCTAAGAGGCATGTGAAGCGCGAAGCCATTGAAGGCAAGGTTGTCTGGATCACAGGGGCTAGCCGTG
GAATTGGGGAAATTCTTGCTAAACAGTTTGCAAGTTTAGATGCCAAGCTTATTCTCTCCGCGAGAAATAAAGCTGAACTG
GAACGGGTTAAGAGTGAACTCAAAGGTAAATACGCTCCAGAAGATGTAAAGGTTTTGCCTTTAGATTTAGCTAGTGGCGA
AGAATCGCTCAAACATGTTGTAGAGCAAGCAGTGTCGCTTTTTCCTGGGGCTGGTGTTGACTATTTGGTTCACAACGCTG
CCTATGAGCGTCCCAAATCCAAGGCATCGGATGCAACTGAGGAAACTCTCAAGACTACATTCGATGTTAATGTCTTTGGG
ACAATAACTCTCACAAAGTTGGTAGCTCCTTATATGCTAAACCAAGGAGGTGGCCATTTTGTTGTGATAAGCAGTGCTGC
AGGAAAGGTGCCATCACCTGGACAGGCTATATATTCTGCTTCAAAGCATGCTCTGAACGGCTACTTCCACAGCTTGCGTT
CTGAGTTCTGTCAGAAGGGAATCAAGGTTACTGTCGTTTGTCCTGGTCCAATAGAAACCTTGAATGGTACAGGAACATCA
ACTTCGGAAGACAAGAAGTCTCCTGAGAAGCGTGTGTCATCTGAACGATGTGCAGAACTGACTATAATAGCTGCATCTCA
TAACTTGAAGGAGGCTTGGATTTCATGTCAGCCGGTACTGCTCGTGATGTATCTAGTGCAGTACATGCCTTCTCTTGGCT
TCTGGCTCATGGACAAGGTGGGAGGGAATCGTGTGGAGGTTGCAGAAAAGAAAGGCAACACATACTCATGGAATTTACTG
TTCAGGAAGAAGACTAAAACAAAGGATATTTAG