Details for Capsella Locus Carubv10014153m

Position : scaf_3 ( 5`- 2944388 .. 2945567 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014153m

Protein [Map View]
MASPAKFQCSVPKLNLQIKLERKASQNLSFPHLFRDKAKSTPVVIRASSSSTPSNPKPSLLKTTCITLTAAAALFSASSY
LISKPAATTPATTVLEATLEKHLETQSNDVEALLSLAKIKFKSDKYEETIETMNRLIEIEPYEQRWPVMKARILSYFSKS
ELAIQAFEEILLSDPTRVDALHYLVMEFYESKPKLLEVEKRIKYAIRRCKNNNNKKKDIRGLRMLIAQIKVMEGNTAEAI
RICEELVKDDPEDFKIYLFQGLVYTLIGKGDEAAKQFERVGRILPENSPYLETMVNTKEWGAIVDYDNVFCYLSTFTKLF
VASLFGKRGDD*

DNA
ATGGCGTCTCCGGCGAAGTTTCAATGCTCTGTACCAAAGTTAAACCTTCAGATCAAGCTCGAGAGAAAAGCTTCTCAAAA
TCTTTCGTTTCCCCATTTATTCAGAGACAAAGCAAAGTCAACACCAGTCGTAATCCGAGCTTCATCCTCATCTACTCCGT
CGAATCCCAAACCATCGCTTCTCAAAACTACCTGCATCACACTCACCGCAGCCGCGGCTCTGTTCTCAGCATCCTCTTAC
CTCATCTCCAAACCAGCCGCGACGACTCCCGCTACTACCGTGTTAGAGGCGACGCTCGAGAAGCACCTCGAGACACAATC
GAACGATGTGGAAGCTTTACTATCTCTCGCGAAAATCAAATTCAAGTCCGATAAATATGAGGAGACGATAGAAACTATGA
ACCGTCTGATCGAAATCGAGCCATACGAACAAAGATGGCCGGTTATGAAGGCTCGGATCCTTTCCTACTTCAGCAAAAGC
GAATTAGCAATCCAAGCTTTCGAAGAGATTCTTTTGAGTGATCCGACTCGCGTAGATGCTTTACATTACTTGGTGATGGA
GTTTTACGAATCTAAGCCCAAATTATTAGAGGTAGAGAAGAGGATCAAATACGCGATTCGAAGATGCAAGAATAATAATA
ATAAGAAGAAAGATATTCGCGGTTTGAGAATGTTGATCGCGCAGATTAAGGTAATGGAAGGAAACACGGCTGAAGCGATT
CGGATTTGTGAAGAGCTAGTGAAGGATGATCCGGAGGATTTCAAGATATATCTGTTTCAAGGATTGGTGTATACATTGAT
AGGGAAGGGAGACGAAGCTGCGAAACAGTTCGAGCGAGTTGGTAGGATTCTTCCGGAGAATAGTCCGTACCTAGAGACTA
TGGTTAACACCAAGGAATGGGGAGCCATCGTAGATTACGATAATGTCTTCTGCTATTTATCCACCTTTACTAAGCTTTTT
GTGGCTTCCTTGTTTGGGAAGCGAGGAGATGACTGA