Details for Capsella Locus Carubv10014152m

Position : scaf_3 ( 5`- 8728249 .. 8729484 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014152m

Protein [Map View]
MKFSISALRQVQPILSFKNKLSMVNVNSFLNPKEKVVFVMGATGSGKSRLAIDLATRFQSEVINSDKIQLYKGLDVLTNK
VTPQECRGVPHHLLGVFDSEFGNLTATQYSNLASQAITKLSANHKLPIVAGGSNSYIEALANHSAGFLLNNYECCFIWVD
VSLPVLNSFVSKRVDRMMEAGLLEEVREVFNPKADYSVGIRRAIGVPELHEYLRYESLVDSATQRMMLDVAVKNIKKNTE
ILACRQLKKIQRLNKKWKLSMHRVDATEVFLKRNVEEQDEAWESLVARPSERIVDKFYNNNSNQVKNDHDVEHCLAASYG
GGSGTRAHNMI*

DNA
ATGAAATTCTCAATCTCAGCACTGAGGCAGGTACAACCAATCTTGAGCTTCAAGAACAAGTTATCTATGGTCAACGTCAA
CTCTTTTCTCAATCCCAAAGAGAAAGTCGTTTTTGTTATGGGAGCTACCGGATCGGGTAAGTCTCGTCTAGCCATCGACC
TAGCAACTCGTTTTCAATCAGAGGTCATAAACTCCGACAAGATTCAACTTTACAAGGGCCTAGACGTGCTCACGAACAAA
GTAACCCCTCAAGAATGCCGAGGCGTGCCTCACCATTTGCTTGGAGTATTCGATTCCGAATTCGGAAACCTAACGGCCAC
TCAGTACAGCAACCTTGCGTCACAAGCAATCACAAAACTCTCAGCGAACCATAAGCTTCCCATAGTAGCCGGTGGATCAA
ACTCTTACATAGAAGCACTTGCGAACCATTCCGCGGGGTTCTTGTTAAACAACTACGAATGCTGTTTCATTTGGGTCGAC
GTTTCCTTACCCGTACTCAACTCCTTCGTCTCAAAACGCGTTGACCGCATGATGGAAGCAGGACTACTCGAAGAAGTGAG
AGAAGTATTCAACCCTAAAGCTGACTATTCCGTAGGGATACGTAGAGCTATCGGTGTCCCCGAGCTTCACGAATACTTAC
GATACGAATCTCTAGTGGACAGTGCAACACAAAGAATGATGCTTGACGTAGCGGTTAAGAACATAAAAAAGAACACAGAG
ATCTTAGCTTGTCGTCAGCTAAAAAAGATTCAACGTCTGAACAAGAAGTGGAAGTTGTCTATGCACCGAGTAGACGCTAC
TGAGGTGTTCTTGAAACGTAACGTAGAGGAACAAGACGAGGCTTGGGAGAGTCTTGTAGCTAGACCAAGCGAGAGAATCG
TCGATAAGTTTTATAATAATAATAGTAACCAAGTTAAGAATGATCATGATGTTGAGCATTGCTTGGCGGCGTCTTACGGC
GGAGGAAGTGGAACAAGAGCCCACAATATGATATGA