Details for Capsella Locus Carubv10014151m

Position : scaf_3 ( 5`- 6188210 .. 6191566 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014151m

Protein [Map View]
MDSRRSTLSLLLLYTCATLVVVSNGELQRFMEPAKSDGSVSFIVIGDWGRRGSFNQSIVAYQMGRIGEKIDLDFVVSTGD
NFYDNGLFSEHDPNFEQSFSNIYTAPSLQKQWYSVLGNHDYRGDSEAQLSSVLRGIDSRWICLRSFVVDAELVEMFFVDT
TPFVKEYYTEADGHTYDWRAVPSRNSYVKALLRDLEVSLKSSKARWKIVVGHHAMRSIGHHGDTKELNEELLPILKENGV
DLYMNGHDHCLQHISDEDSPIQFLTSGAGSKAWRGDIDPITNNPKSLKFYYDGQGFMSARFTHSDAEIVFYDVFGEVLHK
WVTSKQLLHSSV*

DNA
ATGGATTCTCGTCGATCGACTCTGAGTTTGCTACTATTGTATACCTGCGCCACCCTCGTCGTGGTGTCTAACGGTGAGCT
CCAAAGATTTATGGAGCCGGCTAAAAGCGACGGTTCCGTTAGTTTTATAGTGATCGGAGATTGGGGTCGCCGTGGCTCCT
TTAATCAGTCTATCGTCGCCTATCAGATGGGAAGGATTGGTGAGAAGATTGATTTAGATTTCGTGGTCTCTACGGGAGAT
AACTTCTATGACAATGGATTGTTTAGTGAACACGATCCAAACTTCGAACAATCTTTCTCTAACATCTACACTGCTCCTAG
TCTCCAGAAACAGTGGTACAGTGTTTTGGGGAACCATGACTATAGAGGTGATTCAGAAGCTCAGCTCAGTTCTGTTCTCC
GGGGAATCGACAGCCGTTGGATCTGTCTCCGATCATTCGTTGTCGACGCAGAGTTAGTAGAGATGTTCTTTGTCGACACG
ACTCCTTTTGTGAAAGAGTACTACACTGAAGCAGATGGTCACACTTACGATTGGCGCGCAGTTCCGTCTCGCAACTCTTA
TGTCAAAGCTCTCCTCCGTGATCTCGAGGTTTCCTTGAAGAGTTCTAAAGCCAGATGGAAGATTGTTGTCGGCCACCATG
CGATGAGAAGCATTGGACACCATGGAGACACCAAAGAGCTCAACGAAGAGCTTCTTCCGATTCTCAAAGAGAACGGTGTT
GATCTCTACATGAACGGACACGATCACTGTCTTCAACATATCAGTGATGAAGACAGTCCTATTCAGTTTCTAACCAGTGG
TGCTGGATCCAAGGCTTGGAGAGGAGATATTGACCCTATCACCAACAATCCCAAGTCTTTGAAATTCTATTACGATGGTC
AGGGATTCATGTCCGCTCGGTTCACTCACTCAGACGCAGAGATTGTCTTCTACGATGTCTTTGGTGAGGTTTTGCACAAA
TGGGTTACTTCTAAACAACTTCTTCATTCCTCGGTTTGA