Details for Capsella Locus Carubv10014150m

Position : scaf_3 ( 5`- 5059980 .. 5062280 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014150m

Protein [Map View]
MSGRNRGPPPPSMKGGSYSGLQAPVHQPPFVRGLGGGTVPPPPHPSMIDDSRETQFRVDARGLPPQFSIMEDRLAAQNQD
VQGLLADNQRVVAIHIALKQELEVAQHELQRVMHYIDSLRGEEEIMMREMYDKSMRSEMELREVDAMRAEIQKIRVHIKD
LTSGRQELTSQVHVMTQDLARLTSDLQQIPTLTAEIENTKQELQRARAAIDYEKKGYAENYEHGKIMEHKLVAMARELEK
LRAEIANSESRAHATGPFGNPGGVAYGGGYGNPEAGYPVNPYQPNYVVNPAQAGVAGYYPPPYGPQAAWAGYDPQQQQQQ
PQPPPQGQQGHR*

DNA
ATGTCTGGTAGAAATCGAGGACCTCCTCCTCCTTCGATGAAAGGTGGGTCTTACAGTGGCTTACAAGCTCCGGTTCATCA
ACCACCTTTCGTTAGAGGCTTGGGAGGAGGAACAGTGCCTCCTCCACCTCATCCTTCTATGATTGATGATAGTAGAGAAA
CTCAATTCAGAGTTGATGCAAGAGGTCTTCCTCCACAGTTTTCTATCATGGAGGATCGTCTTGCTGCTCAGAACCAAGAT
GTTCAGGGCTTACTTGCTGATAACCAGAGGGTGGTTGCAATTCATATCGCCCTGAAACAGGAACTTGAAGTTGCTCAGCA
CGAATTGCAAAGAGTGATGCATTACATTGATTCCTTGAGAGGTGAGGAAGAGATCATGATGAGGGAGATGTATGATAAAT
CTATGCGATCTGAAATGGAATTGCGTGAAGTTGACGCTATGCGAGCTGAGATTCAAAAGATCCGTGTGCATATTAAAGAC
TTAACTTCGGGTAGGCAAGAACTTACCAGCCAGGTTCATGTGATGACTCAAGATTTGGCTAGACTTACATCAGATTTGCA
GCAGATACCAACACTAACTGCAGAAATTGAGAACACAAAGCAAGAGTTGCAAAGAGCTAGAGCGGCTATTGATTATGAGA
AGAAAGGGTACGCGGAAAATTACGAGCACGGCAAAATTATGGAGCATAAATTAGTTGCAATGGCTCGCGAACTGGAGAAG
CTTCGAGCAGAGATTGCTAACTCAGAGTCGAGAGCTCATGCAACTGGCCCTTTTGGGAATCCTGGTGGAGTTGCCTATGG
CGGTGGCTATGGAAATCCTGAGGCTGGGTATCCTGTGAATCCTTATCAACCCAACTATGTCGTGAATCCAGCACAAGCAG
GCGTTGCTGGCTATTATCCTCCTCCTTACGGACCACAGGCTGCGTGGGCTGGCTACGATCCGCAGCAGCAACAGCAGCAG
CCTCAACCGCCGCCACAAGGACAACAAGGACATCGATGA