Details for Capsella Locus Carubv10014139m

Position : scaf_3 ( 5`- 1460520 .. 1462388 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014139m

Protein [Map View]
MAFLSSSSSSSPAMQKGIFVSIPVLVLSASFAAAAFFLLSSSFSSSCSCPPSIPSPLNNAVEAPVGGSGVDVRISPTKDD
IEWVRDLIRSNGLHMQKNELRKGINPRTRDQQLIDLKQYKGISHYEGDEANNHTALPCPGELLVEQHHSNYGEPWAGGRD
VFEFLAESAKLKPNSRVLEIGCGTLRVGLHFIRYLSPQHFHCLEKDELSLMAALRYELPSQGLLHKRPLIVRGDDMEFSK
FGSDTTYDLIYASAVFLHMPDKLVWTGLERLVEKLKPYDGRIFVSHNVKFCSRLGGDKCAQKLASLGLEYLGKQTHDSLL
FNHYEIWFGFRRFKT*

DNA
ATGGCGTTTCTCTCCTCTTCTTCTTCATCGTCTCCGGCGATGCAGAAAGGAATCTTTGTCTCAATCCCCGTACTTGTACT
CTCCGCTTCGTTCGCAGCTGCTGCCTTCTTCCTCCTCTCCTCTTCTTTCTCGTCTTCTTGCTCCTGTCCTCCTTCTATAC
CTTCTCCCCTTAACAACGCCGTTGAAGCACCCGTCGGTGGAAGCGGCGTTGATGTGAGGATATCTCCGACGAAAGATGAT
ATTGAGTGGGTTAGAGATCTGATTAGATCCAACGGTTTGCATATGCAGAAGAATGAGCTTCGGAAAGGGATTAATCCTCG
CACTAGGGATCAACAACTCATAGATCTGAAACAGTACAAGGGTATATCCCATTACGAAGGAGATGAAGCAAACAACCACA
CAGCTCTTCCGTGCCCTGGTGAGTTACTAGTTGAGCAGCATCACAGCAACTATGGTGAACCCTGGGCTGGTGGTCGTGAC
GTTTTTGAGTTCTTGGCTGAATCTGCTAAGCTTAAACCAAACTCCCGTGTTCTTGAAATTGGATGTGGCACGTTGCGTGT
CGGTCTGCATTTTATCCGCTATCTTAGTCCCCAACATTTTCACTGCCTTGAAAAGGATGAGCTTTCGCTAATGGCTGCTT
TAAGATATGAGCTTCCATCTCAAGGTCTTCTACATAAACGACCTCTTATAGTAAGAGGAGATGATATGGAGTTCAGCAAG
TTTGGTTCAGATACAACCTATGATCTGATATACGCAAGTGCAGTCTTTCTCCACATGCCTGATAAACTCGTGTGGACTGG
ACTCGAGAGACTAGTAGAAAAGTTAAAGCCTTACGATGGGAGAATCTTCGTTTCACATAACGTAAAGTTCTGTTCGCGGT
TAGGAGGAGACAAGTGTGCGCAGAAGCTAGCAAGTTTAGGACTTGAGTATCTTGGGAAACAAACACATGATAGCTTGCTG
TTCAATCACTACGAGATCTGGTTCGGGTTTAGACGGTTCAAAACATAA