Details for Capsella Locus Carubv10014137m

Position : scaf_3 ( 5`- 7109345 .. 7112454 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014137m

Protein [Map View]
MPMENDNGHASNVVVTAEQATKISETEVRLPENRQTVVVTDAASGSEIGEQGEGETPVAVAVTVEESGSNLVAELPPRSS
SARVPFSNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFDDPENEDEDDDEDEYETDNDPQED
APDVHANENDQEDDGNSDIEEVAYSDDEAYARALQEAEERDMAARLSALSGFANRVEDVEDESHTSQDAWDEMDPDELSY
EELLALGDIVGTESRGLSADTIASLTSKRYKDGDNQNGTNESCVICRLDYEVDDDLILLPCKHSYHSECINNWLKINKVC
PVCSAEVSTSTSGQS*

DNA
ATGCCCATGGAGAACGACAATGGCCACGCTAGCAACGTCGTCGTCACCGCCGAGCAAGCCACCAAGATCAGCGAGACTGA
GGTGCGCTTGCCGGAGAATCGGCAGACCGTTGTTGTCACAGACGCCGCAAGTGGTAGCGAGATAGGAGAGCAAGGGGAGG
GAGAGACGCCAGTGGCGGTGGCGGTCACCGTGGAAGAGAGCGGATCGAATTTGGTGGCAGAGCTACCTCCCCGATCTTCT
TCCGCTAGAGTTCCCTTCTCTAATCTTAGCCAAATTGATGCAGATCTTGCTCTTGCTCGCACACTCCAAGAACAGGAACG
GGCGTATATGATGCTGACCATGAATAGTGAAATCAGTGACTATGGGAGCTGGGAAACTGGAAGTTATGTATACGATGAGG
ATGAGTTTGATGACCCCGAGAATGAGGATGAGGATGACGATGAAGACGAATATGAAACAGATAATGATCCTCAGGAAGAT
GCACCCGATGTTCACGCCAATGAAAATGATCAAGAAGATGACGGCAACTCTGACATTGAAGAAGTTGCTTATTCAGATGA
TGAGGCCTATGCTAGAGCTCTTCAAGAAGCTGAAGAAAGGGATATGGCAGCTAGATTGTCTGCTTTATCTGGGTTTGCAA
ATCGGGTTGAAGATGTAGAGGATGAGAGTCATACTTCTCAGGATGCCTGGGATGAGATGGATCCTGATGAGCTTTCGTAT
GAGGAGTTGCTTGCACTTGGCGACATTGTGGGAACCGAAAGCAGAGGATTGTCTGCTGATACAATTGCATCTTTGACTTC
AAAAAGATATAAAGATGGAGACAATCAGAACGGAACCAATGAGTCATGTGTTATATGTCGTTTAGACTATGAGGTTGACG
ATGACCTGATACTGCTCCCATGCAAACATTCTTACCACTCGGAGTGCATAAACAACTGGTTGAAGATAAACAAGGTTTGC
CCCGTATGCAGCGCAGAAGTTTCAACTTCCACCTCTGGACAAAGCTGA