Details for Capsella Locus Carubv10014136m

Position : scaf_3 ( 5`- 6133522 .. 6134969 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014136m

Protein [Map View]
MANFGEGRRSGGGGMLPLLALSAVAEYYRLPWKPPVTASLLAANTLVYLRPALIDPFIPHISEVWFNPHLIFKHKDLKRL
FLSAFYHVNEPHLVYNMMSLLWKGIKLETSMGSTEFASMVFALIGMSQGVTLLLAKSLLFFCDYERAYYNEYAVGFSGVL
FALKVVLNSQAEDYSSVYGILVPTKYAAWAELVLVQMFVPNASFLGHLGGILAGILYMKLKGSYSGSDPVTMAVRGVTRL
VTWPLRFLNGMVRSRRRRITGRGRVGRGQTGIAGPGIWRCHSCTYDNSGWLSACEMCGSGRDRGNGWSLSQGPALSSSND
LPLDELRRRRVERFS*

DNA
ATGGCGAATTTTGGTGAAGGGAGAAGAAGTGGAGGCGGAGGGATGTTACCGCTTCTCGCTCTTAGCGCCGTCGCGGAATA
CTATAGACTGCCGTGGAAACCACCGGTAACGGCGAGTCTTTTAGCCGCCAACACTCTCGTCTATCTCAGGCCTGCGTTGA
TCGATCCCTTTATACCTCACATCAGTGAGGTCTGGTTCAATCCCCACCTCATCTTCAAGCACAAGGACTTGAAACGTTTG
TTTCTATCAGCGTTCTACCATGTCAACGAGCCTCACTTAGTCTACAACATGATGTCTCTTCTCTGGAAAGGTATCAAGCT
CGAGACATCTATGGGAAGCACTGAGTTTGCTTCTATGGTCTTTGCACTTATTGGTATGTCCCAAGGAGTTACTCTGCTGT
TAGCCAAGTCGCTTCTCTTCTTCTGCGACTACGAAAGAGCTTATTACAACGAGTACGCCGTTGGATTCTCTGGTGTTCTC
TTTGCTTTGAAAGTTGTTCTCAATTCTCAGGCTGAGGATTACTCTAGTGTTTATGGTATCCTGGTTCCGACTAAGTATGC
TGCTTGGGCGGAACTGGTTCTGGTGCAGATGTTTGTACCGAACGCTTCGTTTCTTGGGCATTTGGGTGGGATCCTTGCTG
GTATTCTCTATATGAAGCTCAAGGGTTCTTACTCAGGCTCTGATCCTGTTACCATGGCGGTTAGAGGTGTAACACGACTT
GTGACTTGGCCCTTGAGGTTTCTGAACGGTATGGTCAGGTCACGGAGAAGGAGGATTACAGGGAGAGGAAGAGTGGGAAG
AGGCCAGACTGGGATAGCTGGACCTGGTATCTGGAGATGCCACTCGTGTACATATGACAATTCTGGATGGTTAAGTGCTT
GCGAGATGTGTGGCTCCGGACGGGATAGAGGAAACGGATGGTCACTGAGTCAGGGACCAGCATTGTCTTCTTCTAATGAT
CTCCCTTTAGATGAGCTGCGCCGCCGACGAGTAGAAAGGTTTAGTTGA