Details for Capsella Locus Carubv10014135m

Position : scaf_3 ( 5`- 1843645 .. 1844814 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014135m

Protein [Map View]
SLSSSILLVSLSLCFLVSTQQQNLSYKKSSSLNHMATVVYQSYFESQHFEPRALKLRLSSPNNLHLSTPLKSHFQDSPIT
PQESNTTTNAASLSTPGPNPGSNSVSWSFLESLSNSSSNDEEKKTLSLFQSPSSRRTLSDESLALCTESLGSETGSDIIH
EDEYLFSVSSESQTVETRTASATSRPSRQDKRRNAMASLPPPLTSMSGFDCIEVKSHRENGRLVMTAAKPPPRNRCLQDR
SNGCVRLAILIGSDDHIEAETKEEEEEETTYTMRDNEEDIPEYYEEEEEVGEEAEKEEEIEVKGVEKIQRSRRCIEGDRR
NRGFLNWESFCVATS*

DNA
TCTCTCTCATCTTCTATCCTACTTGTCTCTCTCTCTCTCTGCTTCCTTGTTTCCACACAACAACAAAATCTCTCTTACAA
GAAATCCTCATCTTTGAACCATATGGCTACTGTTGTATATCAATCTTACTTTGAGTCTCAGCACTTTGAGCCAAGGGCTC
TAAAACTCAGACTCTCTTCTCCTAATAATCTTCATCTATCCACACCTCTCAAATCCCATTTTCAAGACTCTCCCATTACT
CCACAAGAGAGCAATACTACCACTAATGCAGCCTCCTTGTCCACACCAGGTCCCAACCCGGGATCTAACTCAGTAAGTTG
GAGCTTCCTCGAGTCCCTTTCAAACTCGAGCTCCAATGATGAAGAGAAGAAGACATTATCTCTGTTTCAGTCCCCATCTT
CACGTAGAACTCTCAGCGATGAGAGCCTAGCATTGTGCACTGAGAGCCTAGGGAGCGAGACGGGTTCTGATATCATTCAT
GAGGATGAATACTTGTTCTCTGTTTCATCCGAATCACAAACAGTGGAAACTAGAACTGCGTCTGCTACATCAAGACCATC
ACGACAAGATAAGAGGAGAAATGCTATGGCTTCGCTTCCACCTCCTTTGACAAGTATGAGCGGTTTTGATTGCATTGAAG
TAAAGTCTCACCGTGAGAATGGAAGATTGGTAATGACGGCAGCTAAACCTCCTCCGCGTAACCGGTGCCTTCAGGACCGA
AGCAATGGCTGTGTCAGACTCGCGATATTGATTGGTTCTGATGACCACATAGAGGCGGAGACCAAAGAAGAAGAAGAAGA
AGAAACAACCTACACCATGAGAGATAACGAAGAAGACATTCCAGAATACTACGAAGAAGAAGAAGAAGTTGGAGAAGAAG
CTGAAAAAGAAGAAGAAATTGAAGTAAAGGGTGTTGAGAAAATTCAAAGATCAAGAAGATGTATTGAAGGAGATCGAAGA
AACAGAGGATTTCTAAATTGGGAATCTTTCTGTGTTGCCACTTCCTAA