Details for Capsella Locus Carubv10014134m

Position : scaf_3 ( 5`- 3432169 .. 3434080 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014134m

Protein [Map View]
MREDDSDWFARWEEQLPSPEELMPLSQSLISPDLALAFDIRSPSHGNGNSNQPHHHQTTPPTPSQLQLPSSQANSSAEFA
ADSADLGSGAAGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQ
GLSSGGGAGSDPATDRLFASSPVPAHFLHPNRVPSSDHFMPSFVPIATLQQQQQMAAAAAAAAAAAANPHLQPPQFHHRQ
IASAHFGSPTNGGFHSPTSNGQFGSPTSNGFGSPTNGKFDPSFLARQTQQQQQQPIHRMSTPSLHSPVGNYAEDLESANA
NGGRTVLTLFPTRDD*

DNA
ATGAGAGAAGACGACTCGGACTGGTTCGCGAGATGGGAAGAACAGTTACCATCCCCAGAAGAGCTCATGCCTTTATCTCA
ATCTCTTATCTCACCCGATCTAGCTCTAGCCTTCGATATACGAAGCCCTAGTCATGGAAACGGAAACTCAAATCAACCTC
ATCATCACCAAACCACACCTCCTACACCTTCTCAGCTTCAGCTTCCCTCTTCTCAAGCCAATTCCTCAGCCGAATTCGCT
GCAGATTCTGCAGATCTAGGCTCTGGAGCTGCCGGAGACGAACCTGCCCGGACTTTGAAACGACCCCGTCTCGTTTGGAC
GCCGCAGCTGCATAAGCGTTTCGTTGATGCGGTCGCGCATTTAGGGATTAAGAACGCTGTTCCCAAAACCATTATGCAGC
TTATGAGTGTTGATGGGCTAACCAGAGAAAACGTTGCGAGTCATTTGCAAAAGTATAGGCTTTATCTTAAGAGAATGCAG
GGTTTGTCTTCTGGTGGTGGAGCTGGTTCAGATCCGGCCACGGATCGTCTCTTTGCTAGCTCTCCGGTGCCTGCTCATTT
TCTTCATCCGAATCGAGTTCCAAGCTCTGATCATTTCATGCCGTCTTTTGTTCCAATTGCTACTCTTCAACAGCAACAGC
AAATGGCTGCTGCTGCTGCTGCGGCGGCGGCTGCAGCTGCTAATCCTCATTTACAACCGCCTCAGTTCCACCACCGACAA
ATCGCATCCGCTCATTTTGGCTCGCCTACGAATGGGGGATTCCACTCACCGACGAGTAATGGGCAATTTGGATCGCCGAC
GAGTAATGGGTTTGGATCACCGACGAATGGGAAGTTCGATCCTTCGTTCTTGGCGAGGCAAACTCAGCAACAGCAGCAGC
AACCAATTCACAGAATGTCAACACCATCATTGCATAGTCCAGTTGGTAATTACGCTGAGGATTTGGAATCTGCCAATGCT
AATGGAGGGAGAACAGTCTTAACTTTATTCCCAACTCGAGACGATTAA