Details for Capsella Locus Carubv10014133m

Position : scaf_3 ( 5`- 3469407 .. 3470955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014133m

Protein [Map View]
MDFSFNTATESDKVDSALWPHNSKSLIADILTEIDQNVQKMLILIKDGETESTEKFLCLYQSLGETYNDLNQELLNGLLN
VDFNVPSSDHNNASSLAATPLSSFKSGGASLKNQLVSPGSEMLQSLKGDGDVEKNHSAFLLADMFWAELETARRELEARN
IDIETEKKHVLDLESKLSESCSKIKNLESELDDIKGCLGVSETEVSKLWEMLNECKTEKEKLQAGDAADLLDSLRAELKS
REDQIEQMEEYLNQVCLKETEITSESGTNKNVVEELRARVAVLEKQVESQRNVITEREEEKREAIRQLCFSLDHYMSRYS
ELIRSLSDNNKGIPC*

DNA
ATGGATTTTAGTTTTAACACAGCAACAGAATCGGACAAGGTCGACTCAGCCTTGTGGCCGCATAATTCTAAGTCATTAAT
AGCAGATATCTTAACAGAGATTGATCAGAATGTTCAAAAAATGCTGATATTGATTAAAGATGGTGAAACCGAGTCAACGG
AGAAGTTTCTTTGCTTATATCAATCTCTTGGTGAGACTTACAACGATTTGAACCAGGAGCTCCTCAATGGTCTTCTCAAT
GTTGATTTTAACGTGCCATCTTCAGACCACAACAACGCCTCTTCTCTTGCAGCAACTCCACTGAGCTCCTTTAAGTCAGG
AGGAGCCTCTCTTAAGAACCAACTGGTCTCACCTGGTAGCGAGATGCTGCAGAGCTTGAAAGGAGATGGTGATGTTGAGA
AGAACCACTCTGCATTTTTGCTTGCTGATATGTTTTGGGCCGAGCTTGAAACTGCAAGGAGAGAGTTAGAAGCAAGGAAC
ATCGACATTGAGACTGAGAAAAAGCATGTGCTTGACTTAGAAAGTAAGCTTTCAGAATCGTGTTCCAAGATTAAGAATTT
AGAAAGCGAGCTTGACGATATTAAAGGGTGTTTAGGTGTATCAGAAACCGAGGTTTCAAAGCTGTGGGAAATGTTAAATG
AATGCAAGACCGAGAAAGAGAAACTGCAGGCCGGTGACGCTGCTGACTTGTTAGATAGCCTAAGAGCAGAGTTGAAATCA
AGGGAAGACCAGATTGAGCAAATGGAGGAGTATTTGAACCAGGTGTGTCTTAAAGAGACTGAGATTACGTCTGAATCAGG
AACCAACAAGAATGTTGTGGAAGAACTGAGAGCTAGAGTTGCAGTGCTGGAGAAACAAGTGGAGTCTCAGAGAAATGTGA
TAACAGAACGAGAGGAAGAAAAAAGAGAGGCTATAAGACAGCTCTGTTTCTCCCTTGATCATTACATGAGCAGATATTCA
GAGCTTATAAGATCACTTTCAGACAACAACAAAGGTATACCTTGTTAA