Details for Capsella Locus Carubv10014131m

Position : scaf_3 ( 5`- 5889870 .. 5891243 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014131m

Protein [Map View]
MVSKTLFFLLLLTVALVMFLTGTLATAEEEGSETSSSARKPLVKIVKGKKLCDKGWECKGWSQYCCNHTISDFFETYQFE
NLFSKRNSPVAHAVGFWDYRSFITAAAEYQPLGFGTTGEKLQRMKEVAAFLGHVGSKTSCGYGVATGGPLAWGLCYNKEM
SPDQLYCDDYYKLTYPCTPGVSYHGRGALPVYWNYNYGQTGEALKVDLLSHPEYLENNATLAFQAAIWRWMTPPKKHLPS
AHDVFVGKWKPTKNDTASKRAPGFGATINVLYGDQICNSGFDNDEMNNIVSHYLYYLDLIGVGREEAGPHETLSCADQEP
FVSSSSSAPPSSGSSS*

DNA
ATGGTTTCAAAAACGCTATTCTTCCTGCTGCTTCTCACGGTGGCATTGGTCATGTTTCTGACCGGAACTCTAGCCACGGC
CGAAGAGGAAGGTTCCGAGACTTCTAGCTCAGCGAGAAAGCCTCTGGTGAAGATTGTGAAAGGCAAAAAGTTATGCGACA
AAGGATGGGAATGTAAAGGATGGTCCCAGTATTGTTGCAACCATACAATCTCCGATTTTTTTGAGACATATCAATTCGAG
AATCTATTTTCTAAGCGTAACAGCCCGGTGGCTCACGCCGTCGGGTTTTGGGATTACCGATCATTCATCACCGCCGCCGC
TGAGTATCAGCCTCTTGGCTTCGGTACCACCGGTGAGAAACTTCAACGCATGAAGGAAGTCGCTGCGTTTCTTGGCCACG
TTGGTAGCAAAACCTCATGCGGTTACGGGGTTGCAACGGGCGGACCATTAGCTTGGGGATTGTGTTACAACAAGGAGATG
AGTCCTGATCAGCTCTATTGCGACGATTACTACAAATTGACGTACCCTTGTACCCCTGGAGTCTCGTACCACGGCCGAGG
AGCATTACCGGTTTACTGGAATTACAATTATGGTCAAACCGGGGAGGCTTTGAAAGTGGACCTACTGAGTCACCCAGAGT
ATCTGGAGAACAACGCCACGTTGGCGTTTCAGGCGGCGATTTGGAGGTGGATGACACCACCGAAGAAGCACTTGCCGTCA
GCGCACGATGTCTTCGTCGGGAAATGGAAGCCGACGAAGAACGACACGGCGTCGAAACGAGCTCCCGGGTTCGGAGCCAC
CATAAACGTTCTTTACGGCGATCAAATCTGCAACAGCGGATTCGACAACGATGAGATGAACAACATCGTTTCTCACTACT
TGTATTATCTTGATCTGATAGGCGTTGGAAGAGAAGAAGCTGGTCCTCACGAGACTCTATCGTGCGCCGATCAAGAACCC
TTCGTTTCTTCCTCCTCATCTGCTCCTCCGAGCTCTGGCTCCTCTTCTTGA