Details for Capsella Locus Carubv10014130m

Position : scaf_3 ( 5`- 1761326 .. 1763663 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014130m

Protein [Map View]
MSCSERRTVDPLLRGLDEKKESFRRNVVSLAAELKQVRGRLVSQEQSFLKETITRKEAEKRGKNMELEMCKLQKRLEERN
CQLEASAAAADKFIKELEEFRSKLDATKQTAEASADSAQSTQIQCTMLKKQLDDKTRSLREHKDRVTQLGHQLDDLQRDL
SLRECSEKQLREEVMRIEREVRETIAKAGIGGMDCKLQTFLENVSPTKFEMMNRLVEVKDEEITKLKDEIRLMSGHWKHK
TQELESQLEKQRRTDQDLKKKVLKLEFCLQETRSQTRKLQRKGERRDMEIKEIKDLISEKQELNNETWDKQNFWDNSGFK
IVVSMSMLMLVLVSKR*

DNA
ATGTCTTGTTCCGAGAGAAGGACGGTGGATCCACTTTTGAGAGGTTTAGATGAGAAGAAAGAGAGTTTCCGGCGAAACGT
GGTGTCTTTGGCGGCTGAGCTTAAGCAAGTGAGGGGCCGTTTGGTTTCTCAAGAACAATCCTTTCTTAAAGAAACCATTA
CTAGAAAAGAAGCAGAGAAAAGAGGGAAGAACATGGAATTGGAGATGTGTAAATTGCAGAAGAGATTGGAAGAAAGGAAT
TGTCAGCTTGAAGCTTCTGCAGCTGCTGCTGATAAGTTTATCAAAGAGTTGGAGGAATTTCGATCAAAGCTTGATGCAAC
CAAGCAAACGGCAGAGGCAAGTGCTGATTCTGCTCAGTCTACACAGATCCAATGCACAATGCTAAAGAAACAACTTGACG
ACAAAACACGTTCTCTCAGAGAACACAAAGACCGTGTGACTCAGCTTGGTCATCAGCTCGATGATCTACAAAGAGATTTA
AGCCTGAGAGAGTGCTCTGAAAAGCAACTTAGAGAAGAAGTTATGAGAATCGAACGTGAGGTTAGAGAGACCATTGCAAA
GGCTGGGATAGGTGGTATGGACTGCAAGCTCCAAACATTTCTAGAAAATGTCTCGCCAACGAAATTCGAGATGATGAATA
GGCTAGTTGAGGTAAAAGACGAAGAGATAACAAAACTGAAAGATGAGATAAGGCTAATGTCAGGTCACTGGAAACATAAG
ACTCAGGAACTCGAATCTCAGTTGGAGAAGCAGAGAAGAACTGATCAAGATCTGAAGAAGAAGGTACTGAAACTAGAGTT
CTGTCTACAAGAAACACGAAGCCAGACAAGAAAGCTGCAGAGGAAAGGGGAAAGAAGGGACATGGAGATCAAAGAGATAA
AAGATCTGATTTCGGAGAAACAAGAGCTTAATAATGAGACTTGGGATAAACAAAACTTCTGGGACAATTCAGGGTTCAAG
ATCGTTGTATCAATGTCTATGTTGATGTTAGTGCTAGTCTCCAAGAGATGA