Details for Capsella Locus Carubv10014127m

Position : scaf_3 ( 5`- 5208917 .. 5211217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014127m

Protein [Map View]
MALALSAFRVSISRISPFRDSRFSYPATFALAHTKRIMCNSSHSVSSSPSPSDISSSSSSSSSSSTFSLMETSKIARWRP
MCLYYTHGKCTKMDDPTHLEIFNHDCSKELPVTAADLERKKSQGFNFFLVIDLEGKVEILEFPVLIVDAKTMEVVDLFHR
FVRPTKMREQAINKYIEGKYGELGVDRVWHETAIPFKQVVEEFEAWLAGHGLWDKGTDGDLNNAAFVTCGNWDIKTKIPE
QCVVSNINLPPYFMEWINLKDVYLNFYGREARGMVSMMKQCGIKLMGSHHLGIDDTKNITRVVQRMLSEGAVLKITARRS
KSNTRNVEFLFKNRIK*

DNA
ATGGCGTTGGCTCTCTCTGCATTTCGGGTTTCGATATCAAGAATTAGTCCTTTCCGTGATAGCCGGTTCTCTTATCCCGC
CACGTTCGCTTTAGCTCATACCAAACGAATTATGTGCAACTCTTCGCACTCTGTATCGTCATCTCCTTCTCCCTCTGACA
TTTCTTCTTCTTCTTCTTCTTCTTCTTCATCTTCTACTTTTTCGTTAATGGAAACAAGTAAAATTGCAAGGTGGAGACCC
ATGTGTTTGTATTACACTCACGGGAAGTGCACAAAGATGGATGATCCTACCCATTTGGAAATTTTCAACCATGATTGTTC
CAAGGAACTTCCAGTGACTGCAGCCGATCTTGAGAGAAAGAAGTCACAAGGTTTCAACTTTTTCTTGGTTATCGACTTGG
AAGGAAAAGTTGAGATTCTTGAGTTTCCTGTTCTAATCGTAGATGCCAAAACCATGGAAGTCGTAGACTTGTTCCACAGG
TTTGTAAGACCCACAAAAATGAGAGAGCAAGCAATTAACAAATACATCGAAGGCAAGTATGGGGAACTCGGTGTTGATCG
TGTGTGGCATGAGACAGCTATCCCATTTAAGCAAGTTGTTGAGGAATTTGAAGCTTGGTTAGCTGGGCATGGCTTGTGGG
ATAAAGGTACAGATGGGGATCTGAACAATGCAGCTTTTGTAACCTGTGGAAACTGGGATATAAAGACAAAGATTCCTGAG
CAATGCGTAGTTTCAAATATCAATCTTCCGCCATATTTTATGGAGTGGATCAATCTCAAAGACGTCTACTTGAATTTCTA
CGGCCGTGAGGCCAGAGGAATGGTTTCAATGATGAAGCAGTGTGGTATAAAGCTCATGGGAAGTCACCATCTGGGCATTG
ATGACACAAAGAACATCACGAGGGTGGTGCAACGGATGCTCTCAGAAGGTGCAGTTCTCAAGATCACAGCTCGAAGGAGC
AAATCCAATACGAGAAACGTCGAGTTTCTGTTCAAGAACAGGATCAAGTAA