Details for Capsella Locus Carubv10014126m

Position : scaf_3 ( 5`- 6995621 .. 6998433 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014126m

Protein [Map View]
IKIVAGAGQGRGKRRDLCKSPKNLEGEKSRRGTMSRRESRDSDPKRSSSRIDREPSPKRSRRDGKPEAERVLSKKDLDVR
DGTATEQKPRHSLRDAAPLEPDAHGLKRDSENKHSEHHETKKQASHLSDVSRPRPYHQHDDHRSDRKDDRRATFERGSWR
SSRDQSNRRAGDDEKSQHRKDEDKSSWRHDRFHESDDKTQGALSRNRPAFREKKLPEESGNNTDRPTTEEARDTNLNHRR
QNERNWRSNMHSERHERPATGRDRVWNRDDVRGAGSRQSYRADRDNRFRSNERSGFDGSWTRNEKKWDHDLFEEANKSPT
RATEEEQIAKVETLLAS*

DNA
ATAAAAATTGTTGCAGGGGCAGGGCAAGGCCGAGGGAAGAGAAGAGATTTATGTAAAAGCCCTAAAAATCTCGAGGGTGA
GAAGTCGAGAAGAGGAACCATGTCGAGGCGAGAGAGCAGAGACTCAGACCCTAAACGATCTAGTTCTAGAATCGATCGCG
AACCCAGCCCCAAGAGATCAAGAAGAGATGGCAAACCTGAAGCTGAACGAGTTTTGAGCAAGAAAGATTTGGATGTTAGA
GATGGTACTGCCACAGAGCAAAAACCACGTCATTCCTTGAGAGATGCTGCGCCATTGGAACCTGATGCTCATGGTTTGAA
AAGAGACAGTGAAAATAAGCATTCCGAACATCATGAGACCAAGAAACAAGCTTCCCATTTGTCAGATGTATCTCGTCCTA
GACCATATCATCAGCATGATGATCATCGTAGTGACAGAAAGGATGACAGAAGAGCAACTTTTGAGAGGGGATCGTGGAGA
AGTTCAAGAGATCAGAGTAATCGAAGAGCTGGAGATGATGAGAAGTCCCAGCATCGTAAAGACGAAGACAAAAGCTCGTG
GCGGCATGATAGGTTCCATGAGAGTGACGACAAAACTCAAGGAGCACTCTCTAGGAATCGACCGGCCTTCAGGGAGAAGA
AGCTTCCAGAGGAATCTGGGAACAACACAGATAGACCAACAACTGAGGAGGCAAGAGACACAAATCTTAACCATCGCCGA
CAGAACGAGAGAAACTGGAGGAGCAATATGCATTCAGAAAGACATGAGAGACCAGCAACGGGAAGAGACAGAGTGTGGAA
CAGAGATGATGTGAGAGGTGCGGGAAGCAGACAGAGCTATCGAGCTGATAGAGACAACAGATTCCGCAGCAATGAACGAA
GTGGGTTTGACGGAAGCTGGACAAGGAATGAGAAGAAATGGGACCATGACCTGTTCGAGGAGGCAAACAAGAGTCCGACT
AGAGCCACAGAGGAAGAACAGATTGCAAAAGTTGAAACCTTGTTGGCTTCTTAA