Details for Capsella Locus Carubv10014125m

Position : scaf_3 ( 5`- 4361111 .. 4363390 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014125m

Protein [Map View]
MLKQGFRLSIGIQHRVFFIPWVKKSHSAPRILCSEQREHYSSGLVKYVPKKSRKIGEDLTSQPFVDSSEKGIHAGGLDHN
VLGSLLKCNSEEATERTLSGLKDTHVAGSYMNVVSGDDSDEELEESSNEVTSRGYKSTRQLKQAYDQVRIHMEAEQAKSS
KDACKTTQEAENSAIRYLGLRAYSVAELKKKLIGKKYPLEIVDSVINDFQIRGYINDKLYAESFSRSRWSSLSWGPRRIK
QALFKKGISNEDSEMAIKLVFEKGQCKEGDEEEEPKHGLSKEAVDQLFVQASKRWLQGRDLPIDTRKARVIRWLQYRGFN
WGVVSQLLKRLECTHES*

DNA
ATGCTGAAACAAGGGTTTAGGTTATCGATTGGCATCCAACATCGCGTCTTCTTTATTCCATGGGTGAAGAAGAGTCACTC
TGCGCCGAGAATCTTGTGCTCAGAGCAGCGGGAACACTATTCTTCTGGACTGGTTAAGTATGTTCCAAAGAAGTCTCGCA
AGATTGGTGAAGATTTGACATCTCAGCCTTTTGTTGATAGTTCTGAGAAAGGTATACATGCTGGTGGATTGGATCATAAT
GTATTGGGATCTCTACTGAAGTGTAACAGTGAAGAGGCAACAGAGCGCACATTATCGGGTCTGAAGGATACACATGTTGC
TGGAAGTTACATGAATGTTGTGTCTGGTGATGACTCTGATGAAGAGTTGGAAGAAAGCAGCAACGAAGTTACATCTAGAG
GCTATAAGTCGACCAGACAACTCAAACAAGCTTATGATCAAGTCAGAATACATATGGAAGCTGAGCAGGCCAAGAGTAGC
AAAGATGCCTGCAAAACCACGCAAGAGGCAGAGAATAGTGCTATTCGCTATCTCGGTTTAAGAGCATATTCAGTAGCTGA
GCTGAAGAAGAAGCTTATTGGAAAGAAATATCCTCTTGAAATTGTTGATAGCGTGATCAATGATTTTCAGATCCGAGGTT
ACATCAATGACAAATTGTATGCGGAGTCATTCTCTCGATCTAGATGGTCTTCTTTAAGCTGGGGACCAAGGCGGATCAAG
CAAGCATTGTTTAAGAAAGGCATAAGTAATGAAGACTCGGAGATGGCCATAAAGCTGGTTTTTGAGAAAGGCCAATGCAA
GGAAGGAGATGAAGAAGAAGAACCAAAGCATGGGCTGTCCAAGGAAGCAGTGGATCAGCTTTTTGTTCAGGCATCAAAGC
GGTGGCTCCAAGGCCGAGACTTGCCTATAGACACTCGAAAAGCTAGAGTCATCCGGTGGCTTCAATACAGGGGATTCAAC
TGGGGTGTGGTTTCCCAGCTTCTAAAGAGGTTAGAGTGTACTCATGAGTCGTGA