Details for Capsella Locus Carubv10014123m

Position : scaf_3 ( 5`- 3397159 .. 3399866 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014123m

Protein [Map View]
MAGVNLQLRHAYSIAQFVPTISSPPPPAQRVRFGTSPSRVLFCNLRANSAAAAPTLRTTRREVTTAASSVSSAVDSDSLV
EDRNDGGRIPLLEVKDLRAVIAESRQEILKGVNLVVYEGEVHAVMGKNGSGKSTFSKVLVGHPDYEVTGGSIVFKGQNLL
DMEPEERSLAGLFMSFQSPVEIPGVSNMDFLNMAFNARKRKLGQPELDPIQFYSHLVSKLEVVNMKTDFLNRNVNEGFSG
GERKRNEILQLAVLGAELAILDEIDSGLDVDALQDVAKAVNGLLTPKNSVLMITHYQRLLDYIKPTLIHIMENGRIIKTG
DNTLAKLLEKEGYKAISG*

DNA
ATGGCCGGCGTTAATCTACAGCTCCGTCACGCTTACTCTATTGCTCAATTCGTTCCAACTATTTCTTCTCCTCCTCCTCC
TGCTCAACGAGTTCGGTTTGGAACTTCACCCTCTCGTGTTCTCTTCTGCAATCTCCGAGCTAATTCCGCCGCCGCTGCTC
CAACCCTGAGAACCACCCGCCGTGAAGTAACCACTGCCGCGTCTTCCGTATCCTCAGCCGTCGATTCGGATTCGCTGGTG
GAAGATCGCAATGACGGAGGCAGGATCCCGTTGCTTGAGGTTAAGGATTTGAGAGCTGTGATTGCTGAATCGAGGCAAGA
GATACTAAAAGGCGTCAATTTGGTGGTCTACGAAGGAGAGGTTCACGCAGTGATGGGGAAGAACGGTTCAGGGAAGAGCA
CATTTTCCAAGGTTCTTGTTGGCCATCCTGATTATGAAGTGACTGGAGGGAGTATTGTGTTTAAAGGGCAGAATCTACTT
GATATGGAACCAGAGGAAAGATCTCTTGCTGGTCTCTTCATGAGTTTCCAGTCTCCAGTTGAGATCCCTGGTGTTAGCAA
TATGGATTTCTTGAATATGGCATTCAATGCCCGTAAAAGAAAGCTCGGTCAGCCAGAGCTTGATCCAATCCAGTTCTACA
GCCACTTAGTGTCAAAACTTGAAGTTGTGAATATGAAGACCGATTTTCTCAACAGAAATGTCAATGAAGGATTTAGTGGC
GGTGAAAGGAAACGCAACGAGATTCTACAGTTAGCGGTCCTTGGAGCCGAGTTGGCTATACTGGACGAGATTGATTCGGG
GTTGGATGTTGATGCTCTTCAGGATGTGGCAAAGGCGGTGAATGGACTTTTGACACCAAAAAACTCTGTTTTGATGATAA
CCCACTATCAACGCCTACTTGACTACATCAAACCAACTCTCATACACATCATGGAGAATGGAAGAATCATAAAAACCGGA
GACAACACCTTGGCTAAATTACTGGAAAAGGAAGGCTACAAAGCGATATCCGGTTAG