Details for Capsella Locus Carubv10014121m

Position : scaf_3 ( 5`- 6974915 .. 6977845 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014121m

Protein [Map View]
MTSTPSAGRELSSPPSDGISNLRFSNNSDHLLVSSWDKHVRLYDVSTNSLRGEFLHGGAVLDCCFHDDFSGFSVGADNKV
RRIVFNVGKEDILGMHDKAVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGNRLVVAT
AGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIV
YPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSHEPEAIFVR
SVNEIEVKPKPKVYPNPAA*

DNA
ATGACTTCGACTCCGTCCGCCGGTCGTGAGCTCTCGAGTCCGCCGTCCGACGGCATTTCCAATCTCCGATTCTCCAATAA
CAGTGATCATCTCCTCGTTTCTTCGTGGGATAAGCATGTGAGATTGTATGATGTGAGCACTAATTCCTTGAGAGGCGAGT
TTTTACACGGCGGAGCAGTACTCGATTGCTGCTTTCACGATGATTTCTCCGGCTTCAGTGTCGGCGCCGATAACAAAGTC
AGAAGGATTGTTTTTAATGTCGGCAAAGAGGACATTTTGGGGATGCACGACAAAGCAGTGCGATGTGTTGAGTATTCTTA
TGCTGCAGGGCAAGTGATCACCGGATCTTGGGATAAAACAGTTAAATGTTGGGATCCAAGAGGCGCAAGTGGGCCTGAAC
GCACCCAGGTGGGAACATATCTGCAACCAGAGCGTGTTTACTCTATGTCACTTGTTGGAAATCGTTTGGTAGTGGCAACA
GCAGGAAGACATGTAAACATATATGATCTCAGAAATATGTCTCAGCCTGAGCAAAGAAGGGAGTCTTCACTGAAGTACCA
GACAAGATGTGTGCGTTGTTATCCTAATGGAACAGGATATGCTCTTAGCTCTGTTGAAGGAAGGGTTGCAATGGAGTTTT
TTGATCTATCAGAGGCTGCTCAAGCTAAAAAATATGCTTTCAAATGTCATCGCAAATCAGAGGCTGGGAGGGACATTGTT
TACCCTGTAAATTCCATAGCCTTCCATCCAATTTATGGCACCTTTGCAACTGGAGGTTGTGATGGTTTCGTTAACATTTG
GGATGGTAACAACAAGAAGAGGCTATATCAGTACTCAAAGTATCCAACAAGTATCTCGGCACTGTCATTCAGTCGAGATG
GTCAGCTACTGGCTGTTGCTTCAAGTTACACGTTTGAAGAGGGAGAGAAATCGCACGAACCGGAGGCCATCTTTGTAAGA
AGCGTGAACGAAATCGAAGTGAAACCAAAACCCAAAGTATATCCGAATCCTGCTGCGTAA