Details for Capsella Locus Carubv10014120m

Position : scaf_3 ( 5`- 4218337 .. 4220038 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014120m

Protein [Map View]
MAVEAHHLNTLFSSNREMIHPIEADGLVYNTQMRYSTVPTFSPAVECQTSLFNPPLYNIAPVDGLVHKSMKPTMQSVDSS
VTFNSENNANNVDFLRPVSSRKRSREESVVLNTPAYMQSHKSTTDPLMFLGQDLSSNVQQHHFDIDRLISTHVERMRIEI
EEKRKTQGRRIVEAVEQGLMKTLRAKDEEINHIGKLNLFLEEKVKSLCVENQIWRDVAQSNEATVNALRSNLQQVLAAVE
RNRWEEPPAVADDAQSCCGSSDENDSEEERWKLAGEAQDTKRMRREATTLCRNCGKGEASVLLLPCRHMCLCTMCGSSIN
TCPVCKSPKNASLHVNLSS*

DNA
ATGGCCGTTGAAGCTCACCATCTAAACACTCTGTTTTCTTCCAACAGAGAAATGATCCACCCTATTGAAGCAGACGGCTT
AGTTTATAACACCCAGATGAGATACAGCACTGTTCCGACGTTTAGCCCGGCCGTGGAATGTCAAACTTCTCTGTTTAATC
CTCCTTTATACAACATCGCACCTGTTGATGGTTTGGTTCATAAGTCCATGAAACCGACGATGCAATCCGTTGACAGTTCG
GTCACATTCAACAGCGAGAATAATGCTAATAACGTCGATTTCCTCCGTCCTGTGTCGTCGAGAAAACGTTCCAGAGAAGA
ATCAGTTGTTTTGAATACTCCGGCTTATATGCAAAGCCACAAAAGCACCACCGATCCTCTCATGTTTCTTGGCCAAGACT
TGTCTTCTAACGTCCAACAACATCACTTCGATATCGATCGTTTGATATCTACTCACGTTGAGAGAATGAGAATTGAGATT
GAAGAGAAGAGAAAAACGCAAGGGAGGAGGATAGTGGAAGCAGTTGAACAAGGGTTAATGAAGACACTGAGGGCCAAAGA
CGAAGAGATCAATCACATCGGGAAGCTAAACCTCTTTCTAGAAGAGAAGGTCAAGTCTTTGTGCGTTGAGAATCAGATAT
GGCGTGACGTGGCACAGTCTAATGAAGCCACCGTAAACGCACTCCGTTCAAACTTGCAACAAGTTCTCGCCGCCGTGGAG
CGTAACAGGTGGGAGGAGCCACCGGCAGTGGCTGACGACGCACAGTCTTGTTGCGGGAGCAGTGACGAGAATGATAGCGA
GGAAGAGAGGTGGAAGTTAGCGGGAGAGGCGCAGGATACGAAAAGGATGCGTAGGGAAGCGACGACTCTGTGTAGAAACT
GCGGAAAAGGAGAAGCAAGTGTGTTACTGTTACCGTGTAGACACATGTGTCTATGCACTATGTGCGGTTCTTCAATCAAC
ACTTGTCCAGTCTGTAAATCTCCTAAGAACGCTAGTCTTCATGTTAATCTTTCCTCTTAG