Details for Capsella Locus Carubv10014119m

Position : scaf_3 ( 5`- 1263366 .. 1266250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014119m

Protein [Map View]
RERERRRETTLLWIKKIFISVLSAKILTGHRREETERWWCTRILPPSSLQDFGMVREVEVLMDRNADVLTARVHVAPKIA
ADEPEEDFEVKECTEEKTLFENAPNVGSAQRIGAQKSPKTLHGNAKASKQDASLLAVRKPLQPEIKKHIDDDDNCSIASS
VATSMRMGKSVTYGTAPTFKSAQRAEKRREYYQKLEEKNQALEAERNELEQRQKEEQEAALKQLRKNLKFKAKPVPNFYY
EAPPAKPELKKLPLTRPKSPKLNLSRRKSFSDAISSSSREEIPKTVSNRNRHSTGTVQNKDDHKNKNANAALDSPRLRSG
KGKAGLKPVNECAEEACEA*

DNA
AGAGAGAGAGAGAGGAGGAGGGAGACAACTTTGTTGTGGATAAAAAAGATATTCATTTCTGTTTTGTCTGCAAAAATTCT
CACGGGCCATCGGAGAGAGGAGACAGAGAGGTGGTGGTGCACAAGAATCCTTCCTCCTTCCTCCCTACAAGACTTTGGAA
TGGTAAGAGAAGTTGAGGTGCTTATGGACCGAAACGCCGACGTTCTAACCGCTAGAGTCCACGTTGCTCCTAAGATAGCT
GCAGATGAGCCTGAGGAGGATTTTGAGGTCAAAGAATGCACAGAGGAGAAAACTCTTTTTGAGAATGCACCAAATGTTGG
ATCTGCTCAGAGAATTGGAGCTCAAAAATCGCCTAAAACCCTTCATGGAAATGCTAAAGCTTCAAAGCAGGATGCTTCTC
TTCTCGCGGTGAGGAAGCCATTACAACCCGAGATCAAGAAGCATATCGATGATGATGATAATTGCTCCATCGCTTCTTCT
GTGGCAACTTCAATGAGGATGGGTAAGTCAGTGACTTATGGAACTGCTCCGACGTTTAAAAGTGCACAACGTGCTGAGAA
GCGCAGGGAGTATTACCAAAAGCTTGAGGAGAAAAACCAAGCGCTTGAAGCCGAAAGGAATGAGCTTGAACAAAGGCAAA
AGGAAGAACAAGAAGCGGCATTAAAACAGCTTAGAAAGAATCTCAAGTTCAAGGCTAAACCCGTCCCCAACTTCTACTAC
GAGGCCCCTCCTGCAAAACCAGAGCTCAAGAAGCTACCTTTGACGCGTCCCAAGTCGCCAAAACTGAACCTTTCTCGGAG
AAAAAGCTTCAGCGACGCAATCAGCTCATCTTCCCGTGAAGAGATTCCAAAGACAGTCTCTAACCGGAACCGACACAGCA
CAGGAACAGTTCAGAACAAAGACGATCACAAGAACAAGAACGCCAATGCTGCTCTCGACAGCCCTCGATTGAGATCTGGC
AAGGGAAAAGCTGGATTGAAACCAGTGAACGAGTGCGCAGAGGAAGCTTGTGAGGCTTGA