Details for Capsella Locus Carubv10014116m

Position : scaf_3 ( 5`- 4940586 .. 4943076 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014116m

Protein [Map View]
MADRSKGCMRDEFVTYAYILLYIALSSGQIFFNKWVLSSKEINFPYPLGLTLLHMIFSSVLCFILTKVLKIVEVEDGMTL
EIYVTSVIPIGAMFAMTLWLGNTAYLYISVAFAQMLKAIMPVAVFILGVAAGLEMMSCRMLLIMSIISFGVLVASYGELN
INWIGVVYQMGGVVGEALRLIFMELLVKRKGIKLNPISLMYYVSPCSAICLFVPWIFLEKSKMEGNGTWNFHFVVLTLNS
LCTFALNLSVFLVISHTSALTIRVAGVVKDWVVVLVSALLFADTKLTVINLFGYAIAIAGVAAYNNHKLKKEASKVTSET
PADGESIPLVTQANTNTER*

DNA
ATGGCGGATCGGAGCAAAGGCTGTATGAGAGATGAATTCGTGACGTATGCTTACATTTTACTTTACATCGCCCTTTCTAG
TGGTCAAATCTTCTTTAATAAGTGGGTTTTGTCATCTAAGGAAATCAATTTCCCTTATCCGCTTGGATTGACGTTGCTCC
ACATGATCTTTTCCTCTGTCTTGTGCTTTATTCTTACTAAAGTTCTTAAGATCGTGGAGGTTGAGGATGGAATGACACTA
GAAATATATGTTACATCAGTTATTCCAATAGGTGCAATGTTTGCAATGACCCTCTGGTTGGGAAACACTGCCTACCTATA
CATATCAGTTGCATTTGCGCAGATGTTGAAGGCCATAATGCCTGTTGCTGTGTTTATTCTTGGAGTAGCTGCTGGACTTG
AAATGATGAGCTGCAGGATGCTTTTGATAATGTCTATCATTAGTTTCGGTGTTTTAGTGGCTTCTTATGGAGAATTAAAT
ATCAACTGGATCGGAGTGGTTTACCAAATGGGTGGTGTTGTTGGGGAAGCCTTGAGGCTGATATTCATGGAACTTCTTGT
CAAGAGGAAGGGCATCAAATTAAACCCAATCTCTCTTATGTACTACGTGAGTCCCTGCAGTGCTATTTGCTTGTTTGTAC
CGTGGATCTTTCTAGAGAAATCGAAGATGGAAGGCAATGGCACATGGAACTTCCATTTTGTAGTGTTGACCCTTAATTCC
CTCTGTACATTTGCCCTCAACTTGTCAGTTTTCCTGGTGATTTCTCACACAAGCGCTCTCACTATCCGAGTTGCTGGCGT
TGTCAAGGATTGGGTAGTTGTCTTGGTCTCAGCTCTTCTCTTTGCGGACACAAAACTCACAGTCATTAATCTTTTCGGTT
ACGCCATAGCCATTGCCGGTGTAGCAGCTTATAACAACCATAAGCTGAAGAAGGAAGCATCCAAAGTTACCTCAGAAACT
CCAGCTGATGGTGAATCAATACCGTTGGTGACACAAGCTAATACTAATACAGAGAGATGA