Details for Capsella Locus Carubv10014115m

Position : scaf_3 ( 5`- 7633967 .. 7637508 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014115m

Protein [Map View]
MAGAGIHPYHQQWPPAGAPPPPAAVSSAAPPHPPPVHHHHPPPPLLVDNHNRPPYDELRTIFIAGLPDDVKERELLNLLR
WLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDNLQHLVFDAETKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTG
GDCTHSVYSPSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPAPTPIAAPSSYVPVQNIKDNPPCNTLFIGNL
GENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVIPSSGSVGMRIQYSKNPYGKRKEGPG
YSFFPSPNANGAQGALTYQ*

DNA
ATGGCCGGCGCCGGAATCCACCCTTACCACCAGCAATGGCCGCCGGCAGGGGCACCTCCTCCTCCCGCCGCAGTCTCCTC
AGCTGCTCCACCACATCCCCCGCCCGTTCATCACCATCATCCTCCTCCTCCCCTTTTAGTTGACAACCATAATCGTCCTC
CTTACGACGAGCTTCGGACAATCTTCATCGCAGGTCTTCCCGATGATGTAAAAGAGAGAGAGCTTTTGAATCTCTTGAGA
TGGTTGCCTGGTTACGAGGCTTCTCAGGTGAACTTCAAGGGAGAAAAGCCCATGGGGTTTGCTCTTTTCTCCACAGCTCA
GTTTGCAATGGCAGCCAAAGATAACCTTCAGCATCTGGTGTTTGATGCTGAGACGAAGTCTGTTATACATACGGAGATGG
CCAAGAAGAATCTCTTTGTTAAAAGAGGAATAGTTGGGGACTCAAATGCATATGATCAAAGTAAGCGCCTACGAACTGGA
GGTGACTGCACACATTCTGTGTATAGTCCATCTCCTTTCCACCCTCCACCTCCTCCAGTATGGGGACCACCTCATGGGTA
TATGGCACCTGCACCTCCACCATATGATCCCTATGCAGGTTATCATGCTCCCCCTGTACCAATGCCTGCGCCCACACCTA
TAGCAGCTCCTAGTTCATATGTGCCTGTCCAGAATATAAAGGATAATCCACCTTGCAATACCCTATTTATTGGTAATCTT
GGGGAGAATATAAACGAAGAAGAATTGAGGAGCCTGTTGAGCGCGCAACCTGGTTTCAAACAAATGAAGATTCTGAGACA
AGAAAGGCATACAGTCTGCTTTATTGAATTTGAGGATGTCAATAGTGCCACAAATGTTCACCATAATTTGCAAGGTGCTG
TCATTCCAAGTTCTGGTTCAGTTGGCATGAGGATCCAATATTCAAAGAATCCATATGGTAAGAGAAAGGAAGGCCCAGGC
TATTCTTTCTTTCCTTCTCCGAATGCAAATGGAGCCCAAGGAGCTTTGACATATCAGTAG