Details for Capsella Locus Carubv10014111m

Position : scaf_3 ( 5`- 5420671 .. 5422945 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014111m

Protein [Map View]
MEKKKVATPLVCHGHSRPVVELFYSPITPDGFFLISASKDSHPMLRNGETGDWIGTFEGHKGAVWSSCLDNNALRAASAS
ADFSAKLWDALTGDVLHSFEHKHIVRACAFSQDTKCLITGGFEKILRVFDLNRLDASPTEIDKSPGSIRTVTWLHGDQTI
LSSCADIGGVRLWDVRSGKIVQTLETKSPVTSAEVSQDGRYITTADGSTVKFWDANHFGLVKSYDMPCNIESASLEPKSG
NKFVAGGEDMWVRLFDFHTGEEIGCNKGHHGPVHCVRFAPTGESYASGSEDGTIRIWQTGPVNPEEIIESKSKKNVDEVV
RKIEGFHINKEGKTAEKPSDV*

DNA
ATGGAGAAGAAGAAAGTGGCGACTCCACTAGTGTGCCATGGCCATTCGAGACCTGTTGTGGAGTTGTTCTACAGTCCAAT
CACACCTGATGGTTTCTTCCTCATCAGCGCCAGCAAAGATTCTCATCCAATGTTGAGAAATGGGGAAACTGGAGACTGGA
TTGGTACTTTTGAAGGGCATAAAGGTGCTGTGTGGAGTTCTTGTCTCGATAACAATGCCTTGCGTGCTGCTTCCGCTTCC
GCTGATTTTTCTGCGAAACTTTGGGATGCTTTGACAGGGGATGTCCTGCATTCTTTTGAGCACAAGCATATTGTACGAGC
ATGCGCCTTCTCCCAGGATACGAAATGTTTAATCACAGGAGGATTTGAGAAAATTCTTCGTGTTTTCGACTTGAATCGCT
TGGATGCATCTCCTACAGAAATTGATAAATCTCCTGGTTCTATTAGAACAGTAACATGGCTTCATGGTGACCAAACAATA
TTAAGTTCTTGTGCTGATATTGGTGGTGTGAGGTTATGGGACGTGAGGAGTGGTAAAATTGTGCAAACATTAGAAACCAA
GTCTCCTGTCACCAGTGCTGAAGTGAGTCAAGATGGACGGTATATAACAACTGCTGATGGATCAACTGTTAAATTTTGGG
ATGCAAATCATTTTGGACTAGTGAAGAGTTACGACATGCCCTGCAATATTGAATCTGCATCGCTTGAGCCAAAATCTGGC
AACAAATTCGTTGCTGGTGGAGAAGATATGTGGGTTAGACTATTTGATTTCCACACTGGAGAGGAGATTGGATGCAACAA
GGGACATCATGGTCCGGTTCACTGCGTAAGGTTTGCACCGACAGGCGAATCTTATGCTTCAGGATCTGAAGATGGCACAA
TCAGAATCTGGCAGACTGGTCCCGTGAATCCTGAAGAAATCATCGAATCAAAGTCGAAGAAGAATGTAGACGAGGTTGTT
CGTAAGATTGAAGGCTTTCACATTAACAAGGAAGGGAAAACAGCAGAGAAACCATCTGATGTCTAA