Details for Capsella Locus Carubv10014109m

Position : scaf_3 ( 5`- 7507110 .. 7509272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014109m

Protein [Map View]
MEKHDFFTFLKVYPSRGKDFEVTISIFEFEGSEKKKKKLLETSNRIDHLITGDVAKYSALAIMFYRGYGDGPDGREMGPK
RQRMIDQGPPGPFYGPHPGSAYMYNPYGFVAPPPPPPFPVVRLRGLPFDCAELDVVEFFHGLDVVDVLFIHKNNKLTGEA
FCVLGYPLQVDFALHKNRQNMGRRYVEVFRSTKQEYYKAIANEVAESRVHGMASGGGGGGVGSGGGMSGASSPRRHVQRA
RSSDDGKENIEHTGILRLRGLPFSAGKEDILDFFKDFDLSEDSVHVTVNGEGRPTGEAFVEFRNAEESRAAMVKDRKTLG
SRYIELFPSSIEELEEALSRGR*

DNA
ATGGAAAAACATGATTTTTTCACATTTCTAAAAGTTTACCCTTCAAGGGGAAAAGATTTCGAAGTCACGATTTCGATTTT
CGAATTCGAAGGCTCAGAGAAGAAGAAGAAGAAGCTCCTGGAAACTTCCAATCGAATTGATCATCTAATTACAGGCGACG
TAGCAAAATACTCTGCGTTGGCGATAATGTTCTACAGAGGATATGGAGATGGTCCTGATGGGCGTGAGATGGGACCTAAG
CGTCAAAGAATGATTGATCAAGGTCCTCCTGGACCATTCTATGGACCTCATCCTGGTTCTGCTTATATGTATAACCCTTA
TGGGTTTGTTGCTCCTCCTCCACCTCCTCCTTTTCCTGTTGTTCGACTCCGTGGTTTACCCTTTGACTGCGCAGAGCTTG
ATGTTGTAGAGTTTTTCCATGGTTTAGATGTGGTCGATGTCCTGTTTATTCACAAGAACAATAAGCTTACTGGAGAAGCC
TTTTGCGTTCTTGGTTATCCCCTCCAGGTCGATTTTGCTCTTCATAAGAACAGGCAGAATATGGGAAGGAGATATGTCGA
AGTTTTTAGGAGTACGAAACAAGAGTACTATAAGGCCATTGCTAATGAGGTTGCGGAGTCTCGTGTCCATGGTATGGCTA
GTGGGGGTGGTGGAGGTGGAGTTGGCAGTGGAGGCGGAATGAGTGGTGCAAGTTCACCTCGCAGGCACGTGCAGAGGGCT
AGATCGAGTGATGATGGGAAAGAGAATATTGAGCATACGGGTATCTTGAGATTGAGAGGATTACCGTTTTCAGCGGGAAA
GGAAGACATACTTGACTTCTTCAAAGATTTTGATCTGTCAGAAGACTCTGTTCATGTTACTGTTAATGGTGAAGGGAGAC
CCACTGGGGAAGCGTTTGTGGAGTTTAGGAATGCGGAAGAGTCACGAGCTGCAATGGTCAAGGATAGGAAGACGCTTGGG
AGCCGTTACATAGAATTGTTTCCTTCATCGATTGAGGAGTTAGAGGAGGCACTATCAAGAGGAAGGTGA