Details for Capsella Locus Carubv10014108m

Position : scaf_3 ( 5`- 4408676 .. 4411263 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014108m

Protein [Map View]
NNKNLKYGHLITSLPKPAKKMSTDISPYSQTHVEPVNGYPSDNQRCGDSSAPATYDDLVRNSALFWEKLRALLGLTSKTL
KVPTVGGNSLDLHRLFIEVTSRGGIERVVKDRKWKEVIGAFSFPTTITSASFVLRKYYLKFLYQLEHVYYLEKPVSSIQS
TDEAMRSLANDSPNPEEGVDEGQVGYEYHGFIDGKFDHGYLMTVKIGSQEMRGVLYHIPETPRQSQQTMETPSAAVPSSQ
RRHRKKAKLTVVDSQKPKCHRSGYNFFFAEQHARLKPEYPGQERNITKKIGHMWSNLTESEKQVYQDKGVKDVERYRMEM
SEYKSSHESGAAAAAAASTVAQ*

DNA
AACAATAAAAATCTTAAATACGGTCATCTCATTACCTCTTTACCCAAGCCGGCCAAAAAAATGTCGACCGATATTTCACC
CTACTCTCAAACTCACGTGGAGCCCGTTAATGGTTATCCTTCAGACAACCAGAGATGCGGCGATTCCTCTGCTCCTGCCA
CATACGATGATCTTGTCCGTAACTCTGCTCTCTTCTGGGAAAAGCTCCGAGCTTTACTCGGATTGACCAGCAAGACTTTG
AAGGTTCCTACTGTGGGAGGAAACAGTCTTGATCTGCATCGTCTTTTCATCGAGGTTACATCTCGAGGTGGCATCGAAAG
GGTTGTAAAGGATCGCAAATGGAAAGAAGTGATTGGTGCTTTCAGTTTTCCGACAACAATAACAAGTGCATCGTTTGTCT
TGAGGAAGTATTATCTCAAGTTTCTTTATCAGCTGGAACATGTGTACTACCTTGAAAAGCCAGTGTCTTCAATCCAATCA
ACAGATGAAGCAATGAGGAGCCTTGCTAATGACTCTCCAAACCCTGAGGAAGGTGTTGATGAAGGACAAGTTGGGTATGA
GTATCATGGATTCATTGACGGGAAGTTTGATCATGGTTACCTAATGACAGTGAAAATCGGCTCCCAAGAGATGAGAGGTG
TGCTTTACCACATTCCTGAAACGCCAAGGCAGTCCCAACAAACCATGGAAACACCTTCAGCCGCTGTACCGTCATCCCAA
CGCCGGCATAGGAAGAAAGCAAAGTTGACTGTAGTCGATTCTCAAAAGCCCAAGTGCCACAGGAGTGGCTACAACTTCTT
CTTTGCTGAGCAGCACGCTAGGCTTAAACCTGAGTACCCAGGACAGGAACGAAACATTACCAAGAAAATAGGACACATGT
GGAGCAATCTCACTGAATCTGAGAAACAGGTTTATCAAGACAAAGGAGTAAAGGATGTGGAGAGATACAGAATGGAGATG
TCGGAATACAAATCTTCACATGAGTCCGGAGCTGCTGCTGCTGCTGCTGCTTCTACAGTGGCTCAGTAG