Details for Capsella Locus Carubv10014107m

Position : scaf_3 ( 5`- 5068730 .. 5070283 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014107m

Protein [Map View]
MSHEIVPVDPSDVFVDMDPIFPEDSPTSRQFTRSLTFHEQYVWEPYHSEKLPETLASGIQRFLRVANLVESEEPRIAYLC
RFYTFEEAHRIDSSSTGRGVRQFKNSLLQGLEKDDEFTVRRRKEINDIKEIKRVYHAYKEYIITHGAAFNLDDSQREKMI
NARRIASVLYEILKTIDISGTYASSQLKWDEETGEPLDTVTSIEEIHERSELLVEKCKAVEEEERQTHMSQAVGDDSVQS
NHPTQTEIDAIYKEEVQTKEDRTLAIGSMEDDVRASSAVPSMLYENKDLETQEKLNKVEKKIEEMELKLKDVDFWTKMME
TMFSDQIPPSMRANQTEKNKQQ*

DNA
ATGTCTCACGAAATCGTCCCCGTGGATCCCTCCGATGTTTTTGTTGATATGGATCCCATATTCCCGGAAGATTCCCCGAC
CAGCCGCCAGTTCACGAGATCCCTCACTTTTCATGAACAATATGTTTGGGAGCCCTATCACAGCGAGAAGCTTCCGGAGA
CGTTAGCCTCAGGGATTCAAAGGTTTCTTCGTGTAGCAAACTTGGTTGAGTCTGAAGAACCTCGTATTGCTTATCTTTGC
CGGTTTTATACTTTTGAGGAAGCTCATCGCATTGACAGTAGTTCCACCGGAAGAGGTGTACGGCAGTTCAAAAACTCTCT
TCTTCAAGGGCTTGAGAAGGATGATGAGTTTACTGTGAGAAGAAGAAAGGAGATAAATGATATTAAGGAAATCAAACGTG
TTTACCATGCTTACAAGGAATACATTATCACACATGGTGCAGCATTCAATTTGGATGATAGTCAGCGAGAGAAGATGATA
AACGCACGCAGAATTGCTTCTGTTTTGTATGAAATTCTAAAGACAATCGACATAAGTGGCACTTATGCCTCATCCCAATT
AAAGTGGGACGAGGAGACTGGTGAACCCCTTGACACGGTCACCTCCATAGAGGAAATCCACGAAAGATCTGAGTTGCTAG
TTGAGAAGTGCAAAGCAGTGGAGGAGGAGGAGAGACAAACTCATATGTCTCAAGCCGTAGGCGATGACTCCGTCCAGTCA
AACCATCCCACCCAAACTGAAATAGATGCCATCTACAAAGAGGAAGTTCAAACAAAGGAAGACAGAACGTTAGCAATTGG
GTCAATGGAGGACGATGTCAGAGCGAGTTCAGCAGTTCCATCAATGTTATACGAAAATAAGGATCTTGAGACCCAAGAGA
AGCTGAACAAGGTGGAGAAGAAGATTGAGGAGATGGAGCTGAAACTCAAGGATGTTGACTTCTGGACTAAAATGATGGAA
ACCATGTTTTCAGACCAAATACCTCCGTCCATGAGAGCCAACCAAACCGAAAAAAACAAACAACAATAA