Details for Capsella Locus Carubv10014073m

Position : scaf_3 ( 5`- 9329731 .. 9332401 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014073m

Protein [Map View]
MAGVKRKLSTESDVHALHKELDEVSCPVCMDHPHNAVLLLCSSHDKGCRSYICDTSYRHSNCLDRFKKLHSESPNDPTPE
ANLASRETNNESQNEHGTTSRSNFHSGSGNRGSVGDYESLRRRRRVEDEEQSEDFTNLKCPLCRGTVLGWKVVEEVRTYL
DLKNRSCSRESCSFTGNYQDLRRHARRTHPTTRPSDTDPSRERAWRRLENQREYGDIVSAIRSAMPGAVVVGDYVIENGD
RFPGEREAGNGGSDLWTTLVLFQMIGSLDSGGPSGSGSGSGSRSHRSRAWRNHRRSSDRRYLWGENLLGLQDEHNNNDDE
ELRLQNDAGDASTPVPRRRRRFGRPRSSGNHPR*

DNA
ATGGCTGGTGTAAAGCGAAAATTAAGTACCGAGTCAGATGTTCATGCTCTTCACAAAGAACTGGATGAGGTTTCATGTCC
TGTTTGCATGGATCACCCACATAATGCTGTTCTACTGCTGTGCAGCTCTCATGACAAAGGTTGCAGGTCCTACATCTGTG
ATACCAGTTACCGACATTCCAATTGCCTCGACAGGTTTAAGAAACTGCATTCTGAATCCCCAAATGACCCTACTCCCGAG
GCCAACTTGGCTTCAAGGGAAACTAATAATGAATCTCAAAACGAGCATGGTACAACCAGTCGAAGCAATTTTCACAGTGG
CTCTGGTAACCGAGGCTCTGTTGGGGATTATGAATCGCTAAGGAGGAGGAGAAGAGTGGAGGACGAAGAACAGTCAGAAG
ATTTCACAAATTTGAAATGTCCACTCTGCCGGGGTACTGTTTTAGGATGGAAGGTTGTAGAAGAAGTAAGAACATATCTT
GATCTTAAGAACCGAAGTTGCTCCCGAGAATCCTGCTCATTTACTGGCAACTACCAGGATCTGCGCCGCCATGCCAGAAG
GACACACCCAACAACTCGTCCTTCAGACACTGATCCATCAAGAGAGAGAGCTTGGAGGCGGCTTGAGAACCAGAGGGAGT
ATGGAGATATAGTCAGTGCAATCCGTTCTGCCATGCCTGGTGCTGTTGTAGTAGGAGATTATGTTATAGAAAACGGAGAT
AGGTTCCCAGGTGAGAGGGAAGCAGGAAATGGTGGGAGCGACTTGTGGACCACATTAGTATTGTTTCAAATGATTGGGTC
TCTTGACAGTGGAGGTCCTAGTGGTAGTGGCAGTGGTAGCGGATCAAGGTCTCACAGGTCAAGGGCATGGAGGAATCATC
GCCGTTCTTCAGATAGACGATACCTTTGGGGGGAAAATCTATTGGGTCTACAAGATGAACATAATAACAACGATGATGAA
GAGTTGCGTTTGCAGAACGATGCAGGCGATGCTTCTACTCCTGTGCCAAGAAGAAGACGAAGATTTGGACGTCCTAGATC
AAGTGGAAATCATCCCCGATAA