Details for Capsella Locus Carubv10014046m

Position : scaf_3 ( 5`- 4352697 .. 4355415 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014046m

Protein [Map View]
MGSRSRSDNFQSGDGASPGKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIEDN
HVINGKQVEIKRTIPKGAGGNQSKDFKTKKIFVGGIPSTVTEDDLKDFFAKYGNVAEHQIIRDHETNRSRGFGFVIFDSE
EVVDELLSKGNMIDMADTQVEIKKAEPKKSSNRSPPSYGSHPRGRSFNDNYGGYGGPYGGFDGGYGPPGPIRSHGGPTSR
FAGGYGYGRGGPGGVGPEFGGGYGAYGGGNLGAYRSEPPLGYSSRFAPYGSGFGGEGYGSGGYNGGGYGRGGGEGYGGYG
GAGYGGAYESGGPGGSYEGAGGPYGRGYSNSSRYHPYAR*

DNA
ATGGGTTCCAGATCTCGGAGTGATAATTTCCAATCAGGCGATGGTGCCAGTCCAGGGAAAATATTCATCGGAGGATTGCA
CAAGGACACCACTAATACTGTGTTCAATAAGCACTTTGGGAAGTACGGGGAGATTACAGATTCTGTCATTATGCGAGATC
GGCATACTGGGCAACCTAGGGGTTTCGGTTTCATCACCTTTGCTGACCCTTCTGTAGTTGATAAAGTCATTGAAGATAAT
CATGTCATTAATGGGAAACAGGTTGAGATCAAAAGGACTATTCCGAAAGGTGCTGGTGGCAATCAGTCAAAGGATTTCAA
AACTAAGAAGATTTTTGTTGGTGGTATACCCTCCACTGTCACAGAAGATGATCTTAAGGATTTCTTTGCCAAGTATGGGA
ACGTGGCGGAGCACCAGATTATCCGAGACCATGAAACAAACAGGTCCAGAGGTTTTGGTTTTGTAATTTTTGACAGCGAA
GAAGTCGTAGATGAATTATTGTCCAAAGGAAACATGATTGATATGGCAGACACTCAGGTGGAGATCAAGAAAGCTGAACC
AAAGAAATCTTCAAACCGTTCACCTCCTTCTTATGGTAGTCACCCTAGAGGTCGTTCTTTTAATGATAATTATGGCGGTT
ATGGTGGACCGTACGGAGGTTTTGATGGAGGGTATGGTCCTCCAGGTCCCATTAGGTCACATGGAGGCCCTACTAGTAGG
TTTGCTGGGGGATATGGGTATGGTCGCGGTGGACCTGGTGGTGTAGGCCCTGAATTTGGAGGAGGGTATGGTGCTTATGG
GGGTGGAAATTTAGGAGCTTACCGGAGTGAACCACCTCTTGGCTATTCTAGTCGTTTTGCACCCTATGGGAGTGGGTTTG
GTGGTGAGGGATATGGCAGTGGAGGTTATAATGGTGGAGGATATGGTCGTGGGGGAGGGGAAGGCTATGGGGGATATGGT
GGGGCGGGTTACGGTGGTGCATATGAATCTGGTGGCCCAGGTGGCAGTTATGAAGGAGCAGGTGGTCCATATGGGAGGGG
TTATAGTAACAGTAGTCGATACCATCCGTATGCAAGATAG