Details for Capsella Locus Carubv10014038m

Position : scaf_3 ( 5`- 563652 .. 567028 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014038m

Protein [Map View]
MARFCFPCFQNFGGSNQAVTNRGTEISETADNWVSPSDIPLIEPNSKEHRMREAQLGAHTVRSHGMTVARTHMHDWIILV
LLVILECVLLIIHPFYRFVGKDMMTDLSYPLKSNTVPIWSVPVYAMLLPLVIFIFIYFRRRDVYDLHHAVLGLLYSVLVT
AVLTDAIKNAVGRPRPDFFWRCFPDGKALYDSLGDVVCHGDKSVIREGHKSFPSGHTSWSFAGLGFLSLYLSGKIQAFDG
KGHVAKLCIVILPLLFAALVGISRVDDYWHHWQDVFAGGLLGLVVSTFCYLQFFPPPYHTEGWGPYAYFQVLEAARVQGT
ENGAVQQPAQGEEEDGGFMGLHLVDNPSMRREEDVETGRG*

DNA
ATGGCTCGCTTCTGTTTTCCTTGTTTTCAGAATTTTGGGGGTTCTAATCAGGCTGTGACAAACCGGGGGACTGAAATTTC
AGAAACTGCTGATAATTGGGTCTCACCATCTGACATTCCACTCATAGAACCTAATAGTAAAGAGCACAGGATGAGAGAGG
CACAGCTAGGCGCTCACACTGTGAGGTCCCATGGAATGACTGTTGCAAGGACTCACATGCATGATTGGATCATTCTCGTG
TTACTTGTTATTCTCGAGTGCGTACTCCTTATAATCCACCCGTTTTATCGCTTTGTTGGGAAAGATATGATGACTGATCT
CAGTTACCCGTTAAAGAGTAACACCGTACCAATTTGGTCTGTTCCGGTATATGCGATGCTGTTGCCTTTGGTAATCTTCA
TCTTTATCTATTTCCGTCGAAGAGATGTTTATGATCTTCATCACGCGGTGCTAGGTCTCTTGTACTCTGTTCTGGTGACA
GCAGTACTTACCGATGCAATAAAGAATGCAGTTGGTCGACCACGTCCTGACTTTTTCTGGCGTTGTTTTCCTGATGGCAA
AGCGCTTTATGATAGCCTCGGAGATGTTGTATGCCATGGTGATAAAAGCGTCATAAGGGAAGGGCACAAAAGCTTCCCAA
GCGGGCACACGTCATGGTCTTTTGCGGGTCTGGGATTTCTGTCGCTATACTTATCCGGAAAGATTCAAGCATTTGACGGT
AAAGGCCATGTTGCAAAGCTATGCATAGTCATACTCCCTTTGCTATTTGCAGCTCTGGTCGGTATTTCCCGTGTTGATGA
CTATTGGCATCATTGGCAAGACGTCTTTGCAGGAGGCTTGCTAGGTCTTGTGGTCTCTACATTCTGTTATCTTCAATTTT
TCCCGCCACCATATCACACCGAAGGTTGGGGACCATATGCTTACTTCCAAGTGTTAGAAGCAGCGAGAGTGCAAGGGACG
GAGAATGGAGCGGTGCAGCAACCGGCTCAAGGTGAAGAAGAAGACGGTGGGTTTATGGGTTTACATTTGGTGGATAATCC
GAGTATGAGGAGAGAAGAAGATGTAGAAACTGGTAGAGGCTGA