Details for Capsella Locus Carubv10014036m

Position : scaf_3 ( 5`- 7124957 .. 7127507 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014036m

Protein [Map View]
FFSSFVLSFHFVSLSRSERLISHKSVMSSGVNSSGSAAASAAADKMFFCYQCNRTVTISISSSADPFCPICNQGFLEEYE
DRSPNLPPNFNLNSDDSFFPMADPFSTLLPLLFGSSAASPSGMDFMSSSFFGPSMQPQARSTQQIPQSDAFDPVSFLQNH
LQHLRSSGTHVQFVIENHPSDAAHRMPGNLGDYFFGPGLEQLIQQLAENDPNRYGTPPASKSAIDALPTVKVTKDMLKSE
MNQCAVCMDEFEDGSDVKQMPCKHVFHQDCLLPWLQLHNSCPVCRFELSTDDPDYEHRAQGIQASGDGQGSSEGQQTPRR
FSIQLPWPFRRQDGSGSDPGSGSGAPGAGGGNLETRGEDLD*

DNA
TTCTTTTCTTCCTTCGTCCTCTCGTTTCATTTCGTGTCTCTCTCGCGCTCTGAAAGATTGATTTCGCATAAATCCGTCAT
GTCTTCCGGCGTAAATTCAAGTGGCTCCGCCGCAGCATCAGCAGCGGCCGACAAGATGTTCTTCTGTTACCAGTGCAATC
GCACTGTCACAATCTCAATTTCCTCATCCGCTGATCCTTTCTGTCCTATTTGCAACCAAGGGTTTCTTGAAGAATACGAA
GACCGCAGCCCTAATCTTCCCCCCAATTTCAACCTTAACTCTGATGATTCCTTTTTCCCCATGGCTGATCCTTTCTCGAC
CTTGCTCCCTCTCTTATTCGGCTCTTCCGCTGCTTCTCCTTCCGGCATGGACTTCATGAGCTCGAGCTTTTTCGGTCCTT
CGATGCAACCACAGGCTCGCTCCACTCAGCAGATTCCGCAGTCTGACGCGTTTGATCCGGTTTCGTTTCTCCAGAATCAT
CTCCAGCATCTGCGATCTAGCGGTACGCACGTTCAGTTCGTGATCGAGAATCATCCTTCGGATGCTGCTCATCGTATGCC
TGGGAATCTCGGTGACTACTTCTTTGGTCCTGGTCTTGAGCAGTTGATTCAGCAGCTCGCTGAGAATGATCCTAACCGTT
ACGGAACTCCTCCTGCTTCCAAATCAGCGATTGATGCGCTTCCTACTGTCAAGGTAACTAAGGATATGTTGAAATCGGAG
ATGAACCAGTGCGCTGTTTGTATGGATGAATTTGAGGATGGTAGCGATGTTAAGCAGATGCCTTGTAAGCATGTCTTTCA
TCAGGATTGCTTGCTTCCGTGGCTTCAGTTGCACAACTCGTGTCCTGTATGCCGATTTGAGTTGTCGACTGATGATCCTG
ACTATGAGCACAGGGCTCAGGGAATTCAGGCGAGTGGGGATGGACAGGGATCAAGTGAGGGTCAGCAGACTCCAAGGAGG
TTTAGTATACAACTTCCTTGGCCGTTCAGGAGACAAGATGGCTCTGGTTCTGATCCTGGTTCAGGGTCAGGAGCACCTGG
TGCCGGCGGAGGTAATCTTGAGACCAGGGGCGAAGATTTGGATTGA