Details for Capsella Locus Carubv10014029m

Position : scaf_3 ( 5`- 5512231 .. 5515190 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014029m

Protein [Map View]
MQLFNSCCGKGFEGKKKEKTEPSWRIFSLKELHAATNSFNYDNKLGEGRFGSVYWGQLWDGSQIAVKRLKAWSNREETDF
AVEIEILARIRHKNLLSVRGYCAEGQERLLVYEYLPNLSLVSHLHGQHSAECLLDWNKRMKIAISSAQAIAYLHQHATPH
IIHGDVRASNVLLDSEYEARVTDFGYGKLMPDDTGDGATKAKSSNGYISPECVASGNESETSDVYSFGILLLVLVSGKRP
LERLNPTTTRSITEWVLPLVYERKFVDIVDQRLGDEHVEEKLRKLVLVGLMCAQTETEKRPTMSEVVEMLMNESKEEMCE
LEANPLFKNPFSSNENNREQVAEEISDVISEDKDHHQQQQQQP*

DNA
ATGCAACTTTTTAATAGCTGTTGTGGAAAAGGATTTGAAGGGAAGAAGAAGGAAAAGACAGAGCCATCTTGGAGGATATT
TTCATTGAAAGAACTTCATGCGGCCACTAACAGTTTCAATTACGATAACAAGCTCGGTGAAGGTCGATTTGGTAGTGTGT
ATTGGGGTCAGCTATGGGATGGATCACAAATTGCAGTCAAGAGATTGAAAGCTTGGAGTAACAGAGAGGAGACTGATTTT
GCTGTGGAAATCGAGATTCTTGCTCGTATTCGTCATAAGAATTTGTTGAGTGTTCGTGGCTACTGTGCAGAAGGACAAGA
ACGTCTTCTTGTATATGAGTATTTGCCCAATTTGAGCTTGGTTTCACATCTTCATGGCCAGCATTCAGCTGAGTGCCTTT
TAGATTGGAACAAGCGGATGAAGATTGCCATAAGCTCTGCTCAGGCCATTGCCTATCTACACCAGCACGCAACCCCACAT
ATTATCCATGGAGATGTGAGAGCTAGCAATGTGTTGTTAGATTCTGAATACGAAGCTCGTGTTACAGATTTTGGATATGG
TAAGTTGATGCCAGATGATACTGGAGATGGAGCTACCAAAGCCAAAAGTAGTAATGGGTATATCTCACCAGAATGTGTTG
CATCAGGAAATGAATCAGAAACAAGCGATGTGTACAGTTTTGGCATACTTTTGCTGGTACTTGTTAGTGGCAAGAGACCT
CTTGAAAGGCTAAATCCAACAACCACGCGGAGTATAACCGAGTGGGTTTTACCACTAGTTTACGAAAGGAAGTTTGTTGA
CATCGTTGACCAGAGGCTGGGTGATGAACATGTTGAAGAGAAGCTGAGAAAATTAGTCTTGGTAGGGCTAATGTGTGCTC
AGACAGAGACAGAGAAAAGACCAACAATGTCTGAAGTGGTGGAGATGCTGATGAATGAATCAAAGGAGGAAATGTGTGAA
CTTGAAGCCAATCCGCTTTTCAAGAATCCATTTAGCAGCAACGAAAACAATAGAGAGCAGGTTGCAGAGGAAATCTCAGA
TGTGATTTCAGAAGACAAGGATCATCATCAACAACAACAACAACAACCATAG