Details for Capsella Locus Carubv10014026m

Position : scaf_3 ( 5`- 9488115 .. 9490311 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014026m

Protein [Map View]
MMKLSCNVTDSKLQRSLFSFSHSHRSDPVNFIRRGIVSCSQMKKTGLDPLRAVVSADQGSVIRAEQGLGTLADQLRLGSL
TEDGLSYKEKFVVRSYEVGSNKTATIETIANLLQEVGCNHAQSVGFSTDGFATTPTMRKLHLIWVTARMHIEIYKYPAWG
DVVEIETWCQSEGRIGTRRDWILKDCATGEVTGRATSKWVMMNQDTRRLQKVSDDVRDEYLVFCPQEPRLAFPEENNKSL
KKIPKLEDPAQYSMIGLKPRRADLDMNQHVNNVTYIGWVLESIPQEIVDTHELQVITLDYRRECQQDDVVDSLTTSEIGE
TNGSATSGTQGHNDSQFLHLLRLSGDGQEINRGTTLWKKKPSR*

DNA
ATGATGAAGCTTTCGTGTAATGTGACTGATTCCAAGTTACAGAGAAGCTTATTCTCTTTCTCGCATTCTCATCGATCTGA
TCCGGTGAATTTCATCCGACGGGGGATTGTATCGTGTTCTCAGATGAAGAAGACGGGTTTGGATCCTTTGCGAGCGGTTG
TGTCTGCTGATCAAGGAAGTGTGATTCGAGCTGAACAAGGTTTGGGTACTCTCGCGGATCAGCTCCGATTAGGTAGTTTG
ACTGAGGATGGTTTATCGTATAAGGAGAAGTTTGTTGTTAGATCTTACGAAGTTGGTAGTAACAAAACAGCCACAATTGA
AACCATCGCTAATCTCTTACAGGAGGTGGGATGTAATCATGCACAAAGTGTTGGCTTTTCGACTGATGGGTTTGCTACAA
CGCCTACTATGAGGAAATTGCATCTCATTTGGGTTACTGCAAGGATGCATATTGAGATCTACAAGTACCCTGCTTGGGGT
GATGTGGTTGAGATAGAGACATGGTGTCAGAGTGAAGGAAGGATTGGCACAAGGCGTGATTGGATTCTTAAGGATTGTGC
AACTGGTGAAGTCACTGGCCGTGCTACAAGCAAGTGGGTGATGATGAACCAAGACACAAGACGGCTTCAGAAAGTTTCTG
ATGATGTTCGGGACGAGTACTTGGTCTTCTGTCCTCAAGAGCCCAGATTAGCATTTCCGGAAGAGAATAACAAAAGCTTG
AAGAAGATCCCGAAACTGGAGGATCCGGCTCAGTATTCAATGATTGGGCTTAAGCCTAGACGCGCTGATCTCGACATGAA
CCAGCATGTCAATAATGTGACCTATATTGGATGGGTTCTTGAGAGCATACCGCAAGAAATTGTAGACACGCACGAGCTTC
AGGTCATAACTTTGGATTACAGAAGAGAATGTCAACAAGATGATGTGGTGGATTCACTCACCACCTCGGAAATTGGTGAA
ACCAATGGCTCTGCTACGTCTGGCACACAGGGCCACAACGATAGCCAGTTCTTGCACCTCCTGAGGTTGTCTGGAGATGG
TCAGGAGATCAACCGTGGGACAACCCTGTGGAAAAAGAAGCCGTCAAGATAA