Details for Capsella Locus Carubv10014005m

Position : scaf_3 ( 5`- 5185696 .. 5188135 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10014005m

Protein [Map View]
MRVMRSLRGKSGSGFVFRPARLSSLRSVFTGCRAVMLPRFGGPEVLELRENVPVPNLNPNEVLVRAKAVSVNPLDSRIRA
GYGRSVFEPHLPIIVGRDISGEVAAIGNSVKSFKVGQEVFGALHPTALRGTYTDYGILSEEELTEKPSSVSHVEASAIPF
AALTAWRGLKSNARITEGQRLLVFGGGGAVGFSAIQLAVASGCHVTASCVGQTKDRILAAGAEQAVDYTTEDIELVVKGK
FDAVLDTIGGPETERIGINFLRKGGNYMTLQGDAASLTDRYGFVVGLPLATSLLMKKKIQYQYSHGIDYWWTYMRADPEG
LAEIQRLVGAGKLKIPVEKTYPITDVVAAHEAKEKKQIPGKVVLEF*

DNA
ATGCGAGTGATGAGATCATTGCGTGGTAAATCCGGTTCAGGATTTGTATTCCGGCCGGCGAGGTTAAGTTCTCTCCGGAG
CGTCTTTACCGGCTGCCGTGCTGTGATGTTGCCTCGCTTTGGCGGTCCGGAGGTTTTGGAGCTCCGGGAGAATGTTCCGG
TGCCGAATCTTAATCCGAATGAGGTTCTTGTCCGGGCGAAAGCTGTCTCCGTCAATCCTCTTGATTCCAGAATACGAGCT
GGATATGGACGTTCTGTATTCGAACCACATCTACCTATAATAGTTGGACGCGATATCAGTGGTGAAGTTGCAGCAATTGG
GAATTCTGTAAAGTCATTTAAAGTAGGACAAGAAGTTTTTGGTGCATTGCATCCTACAGCGTTGAGAGGTACTTATACTG
ATTATGGAATTCTTTCGGAGGAAGAACTCACGGAAAAGCCATCATCAGTTTCTCATGTGGAGGCAAGTGCCATTCCTTTT
GCAGCGTTGACTGCTTGGCGTGGTTTGAAGAGTAATGCTCGGATAACTGAAGGACAAAGATTATTAGTTTTTGGAGGAGG
AGGAGCAGTAGGTTTTTCTGCAATCCAGCTTGCGGTAGCCTCTGGCTGTCATGTTACAGCCTCATGTGTCGGTCAGACTA
AAGACAGAATACTTGCAGCTGGTGCCGAGCAAGCTGTTGACTACACAACCGAGGACATTGAGTTGGTGGTAAAAGGAAAA
TTTGATGCTGTGTTGGATACTATTGGTGGGCCTGAAACAGAGAGAATAGGCATTAACTTCTTGAGGAAGGGTGGTAACTA
TATGACTCTCCAGGGTGACGCTGCATCATTGACTGATAGATACGGTTTTGTGGTTGGGCTTCCGCTTGCAACTTCACTCT
TGATGAAGAAGAAGATACAATATCAGTATTCTCATGGAATAGACTATTGGTGGACGTATATGAGGGCTGATCCTGAAGGT
CTAGCCGAGATTCAGAGGTTAGTTGGAGCCGGAAAGCTAAAGATACCTGTGGAAAAAACATATCCAATAACCGATGTTGT
AGCAGCTCATGAAGCCAAGGAAAAGAAGCAGATTCCGGGTAAGGTGGTTCTAGAGTTCTGA