Details for Capsella Locus Carubv10013989m

Position : scaf_3 ( 5`- 7713670 .. 7715440 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013989m

Protein [Map View]
MCSAVIRTRIAFDLMEGLESVYAQAMYGMSRESKIMEHQGSDLIWGGNELMMARGLCSSSSSYHHQLINPNLSSCFMSDL
GVIGEVQQQQHVGNRAGSIDPSSLDCLLSATSNSNNTSTEDDEGISVLFSDSQTLWSFGGVSSAESENREITTETKTTAI
KPKSLKRNRGGDEKGSHFRLVRPQDDSEKGGFKLIYDENQSKSKKPRTEKERGGSSNISFQHSTCVSDNAEPDAEAIAQM
KEMIYRAAAFRPVNFGLEIVEKPKRKNVKISTDPQTVAARQRRERISEKIRVLQTLVPGGTKMDTASMLDEAANYLKFLR
SQVKALENLRPKIDPTNLSFSSAPPTFPLFHPSFLPLQNPNQIHHPEC*

DNA
ATGTGCTCTGCCGTTATTAGAACAAGGATTGCGTTTGATCTGATGGAAGGATTGGAATCTGTCTACGCTCAAGCTATGTA
TGGAATGTCACGAGAGAGCAAAATCATGGAGCATCAAGGATCGGATTTGATTTGGGGAGGAAACGAGCTAATGATGGCTA
GAGGACTCTGTTCTTCTTCTTCTTCTTATCACCATCAACTCATTAATCCGAATCTTAGCAGCTGTTTCATGTCTGATCTT
GGTGTTATTGGTGAGGTTCAACAGCAGCAACATGTTGGAAACAGAGCTGGTTCGATAGATCCATCATCGCTCGATTGTTT
ATTATCAGCAACGTCGAACAGCAACAACACTTCAACGGAAGACGATGAAGGTATCTCTGTGCTTTTCTCAGATTCTCAGA
CTCTTTGGAGCTTTGGTGGAGTCTCCTCTGCAGAGTCTGAGAACAGAGAGATCACTACCGAGACGAAAACAACAGCGATA
AAGCCTAAGTCTTTGAAGAGAAACAGAGGAGGAGACGAGAAAGGAAGTCACTTCCGTCTTGTTCGTCCTCAAGATGATTC
GGAGAAGGGAGGTTTCAAGCTCATATACGACGAGAACCAATCGAAATCCAAGAAACCAAGAACAGAGAAAGAACGAGGCG
GTTCATCAAACATTAGTTTCCAACATTCAACTTGTGTCTCTGATAATGCCGAGCCGGATGCAGAGGCGATCGCGCAGATG
AAGGAGATGATATACAGAGCTGCTGCATTTAGACCGGTGAATTTTGGTTTGGAGATTGTTGAAAAACCTAAGAGGAAGAA
CGTGAAGATATCTACGGATCCTCAGACAGTTGCAGCGAGGCAGAGAAGGGAGAGGATAAGTGAGAAGATTAGGGTTTTGC
AAACATTGGTTCCAGGTGGGACGAAGATGGACACTGCTTCAATGCTTGATGAAGCTGCTAATTATCTAAAGTTCCTTAGA
TCGCAAGTAAAAGCTTTAGAAAACTTGAGACCCAAGATTGATCCAACCAATCTCTCATTCTCCTCTGCTCCTCCTACGTT
CCCTTTATTCCACCCATCTTTTCTTCCTTTACAAAACCCTAATCAGATCCATCATCCAGAGTGTTGA