Details for Capsella Locus Carubv10013988m

Position : scaf_3 ( 5`- 5161078 .. 5163574 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013988m

Protein [Map View]
MITVLRRGGADVTVASVETQVGVDACHGIKMVADTLLSDITDSVFDLIVLPGGLPGGETLKNCKPLENMVKKQDSDGRLN
AAICCAPALALGTWGLLEGKKATGYPVFMEKLAATCATAVESRVQIDGRIVTSRGPGTTIEFSITLIEQLYGKEKVDELL
SILLVRPNPGEEFTFTELNQTNWSFEDTPQILVPITEESEEIEAIALVDILRRAKANVVIAAIGDSLEVVGSRQAKLVAD
VLLDEVAEKSFDLIVLPGGLNGAPRFASCEKLVNMLKKQAEANKPYGGICASPAYVFEPNGLLKGKKATTHPRVSDKLSD
QSHIEHRVVVDGNVITSRAPGTAMEFSLAIVEKFYGREKALQLAKATLV*

DNA
ATGATCACCGTGTTGCGTCGAGGTGGTGCTGACGTGACGGTGGCTTCCGTCGAGACGCAGGTTGGCGTTGATGCTTGTCA
TGGCATCAAGATGGTCGCTGACACTCTTCTCTCTGATATTACCGACTCTGTTTTCGACCTCATTGTTCTCCCCGGAGGGC
TTCCTGGCGGCGAGACTCTTAAAAACTGTAAACCTTTAGAGAACATGGTAAAGAAACAAGACTCCGATGGAAGACTTAAC
GCAGCTATCTGTTGTGCTCCTGCGTTGGCTCTTGGTACTTGGGGTCTACTTGAAGGCAAGAAAGCAACAGGTTACCCTGT
TTTTATGGAGAAACTTGCGGCTACTTGTGCCACTGCTGTTGAGTCAAGAGTGCAGATAGATGGAAGAATAGTGACTAGTA
GAGGACCAGGAACCACCATTGAATTCTCTATCACGCTTATAGAGCAGTTATATGGGAAAGAGAAAGTTGATGAACTCTTA
AGTATCTTGCTGGTTCGTCCTAACCCTGGTGAAGAGTTTACTTTTACTGAGCTTAACCAAACAAACTGGTCATTCGAAGA
TACACCACAGATTCTCGTACCCATTACAGAGGAGTCAGAGGAAATTGAAGCTATTGCGCTTGTAGATATCCTGAGGCGGG
CAAAAGCAAATGTTGTGATTGCTGCAATTGGTGATAGTTTGGAAGTTGTAGGATCTCGCCAAGCTAAGCTAGTAGCAGAT
GTGCTTCTTGATGAGGTTGCAGAGAAGTCGTTCGATCTGATTGTGTTGCCTGGCGGTCTAAACGGCGCTCCAAGATTCGC
GAGCTGCGAGAAACTGGTGAATATGTTAAAGAAACAGGCAGAAGCAAACAAACCATATGGAGGAATTTGTGCATCTCCTG
CTTACGTCTTCGAGCCTAATGGTTTACTCAAGGGTAAGAAGGCTACTACTCACCCAAGAGTGAGCGACAAACTTTCAGAC
CAGAGTCATATTGAGCACAGAGTCGTGGTTGATGGAAATGTTATAACGAGCAGAGCTCCAGGGACTGCGATGGAGTTTTC
ACTTGCGATTGTGGAGAAGTTTTACGGGAGAGAGAAAGCCCTTCAGCTCGCAAAGGCAACACTAGTGTGA