Details for Capsella Locus Carubv10013979m

Position : scaf_3 ( 5`- 8803432 .. 8806272 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013979m

Protein [Map View]
MNMDKETEQTLNYLPLGQSDPFGNGNDGSIGDFLGRYCNPQEISPLTLQSFSLNSQISENFPIAGGIRFPPYPGQFGSDR
EFGVLGSQPTTQESNKSSLLDPDSVSDRVHATKSNSRKRKSIPTGNGKESPASSSLTASNSKVSGDNGGSKAGKRSKQDE
ARSSKNGLEKCNSKGDNKDDAKPPEAPKDYIHVRARRGQATDSHSLAERARREKISERMTLLQDLVPGCNRITGKAVMLD
EIINYVQSLQRQVEFLSMKLATVNPRMEFNANSTLSTEMIQPGESLTQSLYAIACSEQRLPSAYYSLGKNMPRFSDTQFP
SNDGFVQAETPGFWENNDLQSIVQMGFGDIQQQSSNNNCSEPTLQMKLEP*

DNA
ATGAACATGGACAAGGAAACAGAGCAAACCCTAAATTACTTACCTTTGGGTCAGAGCGATCCCTTTGGCAATGGCAATGA
CGGTTCAATCGGTGATTTCCTTGGAAGATACTGCAACCCACAAGAGATTTCACCGTTAACTCTACAGTCTTTCTCTCTGA
ATTCTCAGATCTCTGAGAATTTTCCAATCGCCGGTGGAATTAGATTCCCTCCGTATCCAGGTCAATTCGGATCCGATCGA
GAATTTGGGGTTCTTGGGTCACAACCAACGACGCAAGAGAGTAACAAGAGCTCGTTGTTGGATCCAGATTCAGTTTCTGA
TCGAGTTCACGCCACGAAATCTAACTCCAGGAAGAGGAAATCGATACCTACTGGTAATGGCAAGGAGTCTCCAGCTTCTT
CATCTCTTACAGCTTCCAATTCCAAGGTTTCAGGAGATAATGGTGGATCCAAGGCTGGGAAGAGAAGCAAGCAGGATGAA
GCTCGGAGTAGTAAAAACGGATTAGAGAAGTGCAATAGTAAAGGCGATAATAAGGACGATGCTAAGCCTCCTGAGGCGCC
TAAAGATTATATTCATGTTAGAGCTAGAAGGGGGCAGGCAACAGATAGCCACAGTCTTGCTGAAAGAGCAAGAAGAGAAA
AGATCAGCGAGCGAATGACGTTACTTCAGGATTTGGTTCCTGGTTGCAACCGGATTACAGGGAAAGCTGTCATGCTTGAT
GAAATTATAAATTATGTGCAGTCCTTGCAGAGACAAGTCGAGTTCTTGTCCATGAAGCTGGCAACTGTAAATCCAAGGAT
GGAGTTTAATGCTAATTCTACTTTATCCACAGAGATGATTCAACCGGGGGAGTCTTTAACGCAGTCTCTTTACGCAATCG
CTTGCTCAGAGCAAAGACTTCCTTCAGCATACTATTCCCTTGGCAAGAACATGCCCAGATTCTCAGACACACAATTCCCC
TCGAACGATGGATTTGTTCAAGCTGAGACACCGGGGTTCTGGGAAAATAATGACCTGCAAAGCATAGTTCAGATGGGCTT
TGGAGATATCCAGCAACAGAGCAGCAACAACAACTGTTCTGAGCCAACACTTCAGATGAAGCTTGAACCATAG