Details for Capsella Locus Carubv10013976m

Position : scaf_3 ( 5`- 8446250 .. 8448927 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013976m

Protein [Map View]
YHHHHHHSHYNTTQHTEEREREIEQERQKQGERLQFLLFVTRTMDICMDKEPDGVVVYANGDSCNPNQENVSEPLLDSVS
RDDANVHTELRYAEENIEVNEYDVKECTSEVPVGKPTGDDFESKDVTKSSLPAKHGSKSGRGNNKTRNTVPQPFCLATEK
RASSTRSFTSESLESAGLKKFPDGHSKSQNQNTKVTRKPLQPKNKKLSDEEDSCSVASYSTSGAKSAKSRNVATVAPSFR
STERAEKRKEFYTKLEEKHQAMEAEKSQSEARNKEESEAALRKLRKSLRFKANPMPNFYHEGPPPKVELKKVTHKAPPTR
AKSPKLGRRNIKEGNKAKGASRRHETRKPLVISKEGHADETTHLEPETAFVC*

DNA
TATCATCATCATCATCATCATTCTCATTACAACACAACACAACACACAGAAGAGAGAGAGAGAGAGATAGAACAAGAAAG
ACAAAAACAAGGAGAGCGGTTACAATTTCTCTTGTTTGTCACAAGAACAATGGATATCTGTATGGACAAGGAGCCAGATG
GTGTGGTGGTCTATGCGAATGGTGATTCGTGTAATCCGAACCAAGAAAATGTTTCTGAGCCACTCTTAGATTCAGTATCG
CGCGATGATGCGAATGTACATACAGAGCTTCGGTATGCAGAAGAGAACATCGAAGTGAACGAGTATGATGTTAAAGAGTG
TACTAGTGAGGTTCCTGTTGGTAAGCCGACAGGAGATGATTTTGAGTCCAAGGATGTCACTAAGTCAAGTTTACCTGCAA
AGCATGGTTCAAAATCAGGTAGAGGGAATAACAAAACAAGGAACACCGTTCCACAACCGTTTTGTTTAGCGACTGAGAAG
CGTGCTTCGTCTACACGTTCGTTTACGAGTGAATCTCTCGAATCAGCTGGGTTGAAAAAGTTTCCGGATGGGCATAGTAA
ATCACAAAACCAGAACACAAAGGTGACTAGGAAACCATTGCAGCCAAAAAACAAGAAACTTTCTGATGAGGAAGATTCTT
GCTCTGTTGCTTCTTATTCCACGTCGGGTGCAAAGTCTGCTAAATCAAGAAATGTTGCCACCGTAGCTCCTTCATTTCGA
TCCACTGAGCGTGCCGAGAAGCGGAAGGAGTTCTATACAAAACTGGAGGAGAAACACCAAGCAATGGAAGCCGAGAAATC
GCAAAGTGAAGCAAGAAATAAGGAAGAAAGCGAAGCAGCCTTGAGGAAATTAAGAAAAAGTTTGAGGTTCAAAGCAAACC
CAATGCCAAACTTTTATCACGAAGGGCCTCCTCCAAAGGTTGAACTTAAGAAGGTAACACACAAGGCTCCTCCAACTAGA
GCAAAGTCGCCAAAACTAGGACGGAGGAACATAAAAGAAGGGAACAAAGCAAAAGGAGCATCGAGGCGGCATGAAACTCG
AAAGCCTCTAGTGATCTCTAAAGAAGGCCATGCTGATGAAACTACACATTTGGAACCGGAGACCGCTTTTGTGTGCTAA