Details for Capsella Locus Carubv10013974m

Position : scaf_3 ( 5`- 6099907 .. 6103854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013974m

Protein [Map View]
MLKHPNIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDA
KGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKI
CKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKHEYVPSIPDDDDDEEEVDTDDDAFSVQELGSEEGKGS
DSPTIINAFQLIGMSSFLDLSGFFEQENVSERRIRFTSNSSAKDLLEKIETTVTEMGYNVQKKHAKLKVKQEERNQKGQI
GLSVTAEVFEIKPSLNVVELRKSYGDSCLYRQLYERLLKDVGTSSPEQEIVT*

DNA
ATGCTAAAACATCCCAACATTGTTAGATTACATGAGGTATTGGCTAGCAAAACGAAAATTAATATGGTGATGGAACTTGT
CACTGGAGGAGAATTGTTTGACAGAATTGTCTCCAACGGTAAACTAACAGAAACAGATGGAAGAAAAATGTTTCAGCAGT
TGATCGATGGAATCAGCTACTGTCACAGCAAAGGTGTTTTCCACAGGGATCTCAAGCTAGAGAATGTTCTTCTTGATGCT
AAGGGACATATAAAGATCACTGATTTTGGCCTCAGTGCTCTGCCTCAACATTTTAGGGATGACGGATTGTTGCATACAAC
CTGTGGAAGTCCTAATTACGTTGCACCTGAAGTTTTAGCTAACAGAGGCTATGATGGTGCAGCCTCAGATATATGGTCGT
GCGGTGTAATCTTGTATGTCATTTTAACTGGATGTCTTCCATTTGATGATAGAAACCTTGCGGTTCTTTACCAGAAGATA
TGCAAAGGAGACCCACCAATACCAAGATGGTTATCACCAGGTGCAAGAACCATGATTAAGAGAATGCTCGATCCAAATCC
AGTCACAAGAATCACAGTCGTTGGTATTAAAGCCAGCGAGTGGTTTAAACACGAGTACGTTCCTTCAATTCCCGATGATG
ATGATGACGAAGAAGAAGTTGACACAGACGATGATGCCTTCTCAGTCCAAGAGCTCGGATCAGAAGAAGGGAAGGGAAGT
GATTCACCGACCATTATCAATGCGTTTCAGTTAATCGGAATGTCTTCATTTCTTGACCTGTCTGGTTTCTTTGAACAAGA
GAATGTATCAGAGAGGAGAATAAGATTCACTTCAAATAGCTCCGCAAAAGATTTACTGGAGAAAATCGAGACAACGGTAA
CAGAAATGGGATACAATGTACAAAAGAAACATGCGAAGTTAAAAGTAAAACAAGAAGAAAGGAATCAGAAAGGTCAAATT
GGTTTATCAGTAACAGCTGAGGTATTCGAGATAAAGCCGTCACTGAACGTGGTTGAGCTAAGAAAATCTTATGGGGATTC
ATGTTTGTATAGACAGTTGTACGAGAGACTATTAAAAGACGTGGGCACATCCTCGCCGGAGCAAGAGATAGTAACATAG