Details for Capsella Locus Carubv10013971m

Position : scaf_3 ( 5`- 2481987 .. 2485316 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013971m

Protein [Map View]
MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLICERCNAQPASVRCVEERVSLCQNCDWSGHSNSN
NNSSSTSSSSSPPQHKRQTISCYSGCPSSSELASIWSFCLDLAGQSICEQELGLMNIDDNVPTTDKICIEDKKQVLPGSS
SVPETSSAAQGTSSFAKKDVGVCEDDFYGNLGMDEVDLALENYEELFGVAFNPSEELFGHGGIDSLFQKHQTAPEGGNSV
QPACSNDSFMSSKTEPIICFASKPAHSNISFSGVTGESSAGDFQECGASSSLQLSGEPPWYPPASQDNNACSHSVTRNNA
VMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAGEAYDYDPLTPTRSY*

DNA
ATGGGTTACATGTGTGACTTCTGTGGTGAACAGAGATCTATGGTCTACTGTCGATCAGATGCTGCTTGTCTGTGTCTCTC
TTGCGACCGCAGTGTTCATTCCGCTAACGCATTGTCCAAACGACATTCTCGCACTCTCATCTGCGAGAGATGCAATGCTC
AGCCTGCTTCCGTCAGGTGTGTCGAGGAAAGAGTTTCCCTTTGTCAAAACTGTGATTGGTCTGGCCACAGCAACAGCAAC
AACAATTCTTCCTCTACCTCTTCTTCTTCTTCCCCGCCGCAGCATAAGAGGCAAACCATTAGCTGCTATTCTGGCTGCCC
TTCTAGCTCAGAACTCGCCTCTATTTGGTCTTTCTGTTTGGACTTAGCCGGGCAATCCATTTGTGAACAAGAATTGGGTT
TGATGAATATAGACGATAATGTTCCTACTACCGACAAAATTTGTATTGAGGATAAGAAACAAGTCTTGCCCGGTTCCTCT
TCAGTTCCTGAAACCAGTTCTGCTGCACAAGGGACTTCATCATTTGCTAAGAAGGATGTTGGAGTGTGTGAAGATGACTT
CTATGGGAACCTAGGTATGGATGAAGTTGACTTGGCGCTTGAGAACTATGAAGAGCTCTTTGGTGTCGCCTTTAACCCCT
CCGAAGAGCTATTTGGCCATGGTGGAATCGATAGTCTTTTCCAGAAGCACCAAACAGCTCCAGAGGGAGGGAATTCAGTG
CAGCCAGCATGCAGCAATGACTCGTTCATGAGTTCGAAAACTGAGCCAATAATTTGCTTCGCATCGAAGCCAGCACATTC
GAACATTTCCTTCTCTGGAGTCACTGGTGAAAGTAGTGCTGGAGATTTCCAAGAATGTGGTGCATCCTCTTCGCTGCAGC
TCTCAGGCGAGCCACCATGGTATCCTCCAGCATCACAGGATAACAATGCTTGCTCACATTCAGTAACCCGTAATAATGCA
GTTATGCGTTACAAGGAAAAGAAGAAGGCTCGCAAGTTTGATAAGAGAGTGAGGTATGCTTCTCGCAAAGCAAGAGCAGA
TGTGAGACGGCGTGTAAAGGGGAGATTTGTCAAAGCTGGTGAAGCTTATGATTACGACCCTCTCACCCCAACTAGAAGCT
ATTGA