Details for Capsella Locus Carubv10013943m

Position : scaf_3 ( 5`- 4327575 .. 4330483 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013943m

Protein [Map View]
IFVADCAFLGFENTLQRDMEGKISSSEDTNLLQRIKEFTRLVIEDLAEGRSPKISINRFRNYCMNPEADCICSSDNPKGQ
EILTLKREPQTYRIDMLLRVLLIVQKLLQENRHASKRDIYYMHPSAFKAQSVVDRAIGDICILFHCSRYNLNVAFPVPVL
VEEVEDIVSLAEYILVVEKETVFQRLANDMFCKLNRCIVITGRGYPDVSTRRFLRLLIEKLQLPVHCLVDCDPYGFEILA
TYRFGSMQMAYDIESLRAPDMKWLGAFPSDSEIYDVPKQCLLPLTEEDKKRTEALLLRCYLKREMPQWRYQQTSTSFCIY
ISYNSTKTSLDENNFGRLRLELETMLERGVKFEIEALSVHSLSFLSEVYIPSKICLEVTSP*

DNA
ATATTCGTCGCCGATTGCGCATTCCTCGGTTTTGAAAACACACTCCAAAGAGACATGGAGGGAAAAATTTCGAGTTCAGA
AGATACTAATTTGCTTCAAAGGATCAAAGAATTTACTCGATTGGTCATTGAAGATCTTGCTGAGGGAAGATCTCCGAAAA
TTTCAATCAATCGATTTAGGAACTATTGCATGAATCCAGAAGCTGACTGCATTTGCAGCTCTGATAACCCAAAGGGTCAG
GAGATTCTCACTCTTAAGAGGGAACCCCAAACCTACAGAATCGATATGTTGCTAAGAGTATTGTTGATTGTCCAAAAACT
TCTGCAAGAAAATAGACATGCCTCAAAAAGAGATATCTACTACATGCACCCATCCGCATTCAAAGCACAATCAGTTGTGG
ACCGCGCAATTGGTGATATATGCATCCTTTTTCACTGTAGTCGGTACAACTTGAATGTGGCGTTTCCGGTTCCTGTTCTT
GTAGAGGAAGTTGAAGATATTGTTAGCCTAGCAGAGTACATTCTGGTGGTGGAAAAAGAAACAGTATTCCAGCGTTTAGC
AAATGACATGTTTTGCAAGTTGAATCGCTGCATCGTTATCACAGGAAGAGGCTATCCTGATGTCTCAACAAGAAGGTTCT
TGCGACTCCTCATTGAGAAGTTGCAACTACCTGTGCATTGTCTAGTCGATTGTGATCCATATGGCTTTGAAATCCTCGCC
ACATACCGTTTTGGCTCCATGCAAATGGCTTATGATATTGAATCATTACGAGCACCAGATATGAAATGGTTGGGAGCTTT
TCCTTCGGACTCTGAGATATATGATGTTCCCAAACAGTGTCTTTTGCCTTTGACAGAAGAGGATAAGAAAAGAACTGAGG
CACTGTTACTTCGATGCTACCTGAAGCGTGAAATGCCACAATGGAGGTATCAACAAACTTCCACGTCTTTTTGTATCTAC
ATTTCATACAATAGTACAAAAACTAGTCTTGATGAAAACAATTTTGGTCGTCTAAGGTTGGAACTTGAAACGATGCTGGA
AAGAGGTGTGAAGTTTGAGATTGAAGCACTCTCAGTTCACTCACTGTCTTTTTTGTCAGAGGTTTATATTCCTTCTAAGA
TTTGTCTTGAGGTAACTTCCCCTTGA