Details for Capsella Locus Carubv10013942m

Position : scaf_3 ( 5`- 7269450 .. 7271915 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013942m

Protein [Map View]
MIGNPVIQVPSSLMPSSSMIVCPRASPNGLPYLPPKPRTRHLVVRAASNSDAAHGQPSSDEGKNPLTVVLDVPRNIWRQT
LKPLSDFGFGKRSVWEGGVGLFIVSGATLLALSWAWLRGFQMRSKFRKYQTVFELSHASGICTGTPVRIRGVTVGTVIRV
NPSLKNIEAVAEIEDDKIIIPKNSLVEVNQSGLLMETMIDIMPRDPIPEPSVGPLHPECGIEGLIVCDRQKIKGKQGVSL
DELVGIFTRIGREVEEIGVANTYALAERAASVIEEARPLLKKIQAMAEDAQPLLSEFRDSGLLKEVECLTRSLTQASDDL
RKVNASIMTPENTELIQKSIYTLVYTLKNVESISSDILGFTGDEATRKNLKLLIKSLSRLL*

DNA
ATGATTGGGAATCCAGTAATTCAAGTTCCATCATCACTAATGCCATCATCTTCCATGATTGTTTGCCCTCGAGCTTCACC
CAATGGGCTTCCTTATCTCCCACCGAAACCTAGAACTAGGCATTTAGTGGTCAGAGCTGCATCCAATTCCGACGCTGCTC
ATGGTCAACCATCGTCTGATGAAGGGAAGAATCCGCTCACGGTTGTTTTGGATGTGCCCAGGAATATATGGAGACAGACT
TTAAAGCCTTTGAGTGATTTTGGGTTTGGTAAGAGAAGTGTTTGGGAAGGTGGGGTTGGTTTGTTCATCGTCTCTGGAGC
TACGCTTCTTGCTCTTAGCTGGGCTTGGTTGCGAGGGTTTCAAATGCGGTCTAAATTTAGAAAATATCAGACTGTGTTTG
AGCTTAGTCATGCCTCTGGCATTTGTACGGGAACACCGGTTAGGATCCGTGGGGTCACTGTTGGTACTGTGATCCGTGTT
AATCCTTCCTTGAAGAACATTGAAGCTGTTGCTGAGATTGAAGATGATAAGATTATTATACCAAAGAATTCACTGGTTGA
GGTGAATCAGTCTGGTCTTTTAATGGAAACTATGATCGACATCATGCCTAGGGATCCGATACCAGAACCTTCTGTAGGAC
CTCTGCATCCTGAATGTGGTATAGAAGGTCTGATCGTTTGTGATAGGCAGAAGATCAAAGGAAAGCAAGGAGTAAGTTTA
GATGAATTAGTTGGAATCTTTACTCGTATTGGACGCGAAGTAGAGGAAATTGGTGTAGCCAATACATATGCGCTTGCTGA
GAGAGCGGCTTCGGTTATTGAGGAAGCAAGACCATTGCTCAAAAAGATTCAAGCCATGGCTGAAGATGCTCAACCTTTGC
TCTCTGAGTTTCGTGATAGCGGCTTGCTCAAGGAAGTTGAGTGTCTTACTCGAAGCCTTACCCAAGCTTCTGACGATTTG
AGAAAGGTTAATGCGTCGATTATGACACCAGAGAATACAGAACTCATTCAGAAGTCAATCTACACTCTGGTTTACACTTT
GAAAAACGTCGAGAGCATAAGCTCAGATATTCTGGGGTTCACAGGCGATGAAGCGACAAGAAAAAACCTAAAACTACTCA
TCAAATCCCTCAGCAGGCTATTATAA