Details for Capsella Locus Carubv10013938m

Position : scaf_3 ( 5`- 1177613 .. 1178867 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013938m

Protein [Map View]
MARLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDKILDFDASAIVI
EIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDCGGRNNNMRLVTLQIRRPSGRLQGFLRLGVALLDGGQRSMPLSIE
VFDGSRRGERYKEASKIMHRRTNSDLTDLTTSTNDYGVKTGVVTGGGGGGNAIVVGADSMVNGSLCNSDIGPSASVVAAA
IAQGLYNRQKTAVATNSNNKEDASSILEGKTEGVEHRVERWRAEKKGAVETAGSSDESSGKGGAGRRRRRRRRKEKEQGR
RNGGGEGKKGLFSCFGNVFGCEISITCGGGSGGEGDSTKKRYNKNKVVNLSAVDETFSSSAA*

DNA
ATGGCTCGGCTCAAGTTCGCATGTCCCGTTCTTGAAATCAATCTAATCTCAGCTCAAGATCTTGCCCCTGTTTCAAGAAA
CATGAAAACGTATTCCGTAGCTTGGATCAACACCGATCCTATGAGGAAACTCACGACGCGTGTTGATCAATCCAATAGAG
CCAACCCTATATGGAACGAGAAGTTTGTCTTCCGGGTTAACGACAAGATCCTTGACTTTGACGCATCAGCTATTGTCATC
GAGATATACGCAGCGGCTTGGGCTAAAGATGCGCTTGTTGGTACCGTCAATGTTCTTCTTAGCGATCTTTTTGCTCCTTG
GTCTGGTTTTGGTGACGGTGACGACTGTGGTGGTCGGAATAACAATATGAGGCTTGTGACGCTTCAGATTCGTCGTCCTT
CAGGTAGGCTTCAAGGGTTCTTACGGCTCGGCGTTGCGCTTCTTGACGGTGGTCAACGGAGTATGCCGTTATCTATTGAG
GTTTTTGACGGAAGTCGAAGAGGAGAGAGGTATAAAGAAGCTTCAAAGATAATGCACCGCCGTACGAATAGCGATCTAAC
GGATTTAACGACATCAACGAATGATTACGGAGTTAAAACAGGGGTTGTTACCGGCGGTGGAGGAGGTGGTAATGCTATTG
TTGTTGGCGCGGACAGTATGGTGAATGGTTCGCTTTGTAACTCTGATATTGGACCGTCAGCGTCTGTGGTTGCGGCTGCG
ATTGCGCAAGGGCTTTACAACAGACAGAAAACAGCGGTTGCGACGAATAGTAATAATAAAGAGGACGCAAGTTCGATTCT
TGAAGGGAAAACAGAGGGAGTTGAGCACAGAGTTGAGCGGTGGAGAGCGGAGAAAAAAGGTGCGGTTGAAACGGCTGGAT
CCAGCGATGAGTCTAGTGGAAAAGGAGGAGCGGGAAGGAGACGGAGGAGGAGGAGACGAAAGGAGAAAGAACAAGGGCGG
AGGAACGGTGGAGGAGAGGGTAAGAAAGGGTTGTTTTCATGCTTCGGGAACGTGTTTGGATGTGAGATCTCGATAACTTG
TGGCGGTGGAAGCGGCGGAGAAGGAGACAGCACGAAGAAGAGATATAACAAGAATAAAGTAGTCAATCTTAGTGCTGTAG
ACGAAACGTTTAGTAGTTCTGCGGCTTAA