Details for Capsella Locus Carubv10013928m

Position : scaf_3 ( 5`- 3024716 .. 3026897 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013928m

Protein [Map View]
MGNSSSSSSGGGGRRHRRRRNHTHPPAAPPPPSLPPPPPSTDIQPVFAAATPYPNPNSNPVYQYPHSYYNPQPGAMSGPP
LPPYDHHLHHTSHPYHQHSWSPMARYPYAGPMMMAQPAPYVEHQKAVTIRNDVNLKKESLRLEPDPDHPGRFLVSFTFDA
TVSGRISVIFFAKESEACNLTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSTFEDVELFKATDTDIYPLAVKAEAAA
SGENAEEGLDSKKNAQITQAIYEKDKGEIKLRVVKQILWVDGTRYELQEIYGIGNTVEGDDGSADDANDPGKECVICLSE
PRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNSGSGNNTRQQGETTEQE*

DNA
ATGGGAAACAGCAGCAGCAGCAGCAGCGGAGGTGGAGGTAGACGCCACCGTCGCCGGCGAAACCATACGCATCCTCCGGC
GGCTCCTCCTCCTCCTTCTCTTCCTCCGCCACCTCCATCTACAGATATCCAACCGGTATTCGCCGCCGCTACACCGTATC
CAAACCCTAATTCTAATCCGGTTTACCAGTACCCTCATTCTTACTACAATCCTCAGCCGGGTGCCATGTCGGGGCCGCCT
CTTCCGCCGTACGATCACCACCTTCATCATACATCGCATCCTTACCACCAGCACTCTTGGTCCCCTATGGCGAGGTACCC
TTACGCTGGTCCCATGATGATGGCTCAGCCGGCTCCCTACGTTGAACACCAGAAGGCCGTCACGATTCGTAACGATGTTA
ATCTCAAGAAGGAGAGTCTTCGCCTTGAACCTGACCCCGATCATCCGGGTCGGTTTCTCGTCTCCTTCACGTTTGATGCA
ACCGTCTCCGGGAGGATTAGTGTCATTTTCTTTGCTAAAGAATCCGAAGCTTGCAATCTCACAGCGACTAAGGAGGATAT
TCTGCCACCAATCACTCTAGATTTCGAGAAAGGACTCGGTCAGAAGTTTAAACAATCATCTGGTTCGGGTATAGACTTTT
CCACGTTTGAGGACGTTGAGCTGTTCAAGGCCACAGACACAGATATCTATCCATTGGCAGTTAAGGCAGAAGCAGCTGCT
TCAGGTGAGAATGCAGAAGAAGGGTTAGATTCGAAGAAGAATGCCCAGATTACTCAAGCGATTTATGAGAAAGATAAAGG
AGAGATTAAGCTTAGGGTGGTGAAGCAGATACTATGGGTTGATGGAACTAGATATGAGTTGCAGGAAATTTATGGGATTG
GGAATACGGTTGAGGGCGACGATGGTTCAGCTGATGATGCTAATGACCCGGGCAAAGAATGTGTTATATGTTTGTCTGAA
CCACGAGACACCACTGTTCTACCATGCCGACATATGTGTATGTGCAGTGGATGTGCTAAGGTATTGAGGTTTCAGACAAA
TCGATGCCCTATTTGCAGGCAACCTGTCGAAAGGCTTTTGGAGATAAAAGTTCACGGTAACAGCGGAAGCGGGAACAATA
CCAGACAACAGGGAGAGACAACTGAACAAGAATAG