Details for Capsella Locus Carubv10013925m

Position : scaf_3 ( 5`- 4857072 .. 4859561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013925m

Protein [Map View]
MCGGAIISDFIPPPRSRRVTSEFIWPDLKNKGKVSKKRSTKRSDFFDLDEEFEADFQGFKDESSFECDDDVYANVKPFVF
NATTKPVASPASAFVSTGFTSAKKTVESDGQAEKSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAA
RAYDAAARRIRGSKAKVNFPEAKIPSISQKRPSVRTSNLQKPVAKPNQSPTLVQQPTYLSQQYCNNSFDNMGHESFGDVS
FMEEKPQMYNNQFGVTNSFDAGGNNGYQYFSSDQGSNSFDCSEFGWSDHGPKTPEISSMLVNNNQAPFIEETNAAKKLKP
NAEDRMNHNDESDDLMVYLDNALWDTPLEVEAMLGPDAGAVTQEEENPMELWSLDDISFMLEGDL*

DNA
ATGTGTGGAGGAGCTATAATCTCCGATTTCATACCGCCGCCGAGGTCCCGCCGCGTGACGAGCGAGTTTATATGGCCGGA
TCTGAAAAACAAAGGGAAAGTATCGAAGAAGAGATCGACGAAGCGATCAGATTTCTTCGATCTGGACGAAGAATTTGAAG
CTGATTTCCAAGGGTTTAAGGATGAGTCGTCTTTTGAGTGCGATGATGATGTCTACGCAAATGTGAAGCCTTTTGTCTTC
AACGCAACTACCAAACCTGTAGCTTCACCTGCCTCCGCCTTCGTCTCTACTGGTTTTACTTCTGCCAAGAAAACTGTAGA
GTCCGATGGCCAAGCTGAGAAATCTTCTAAGAGGAAGAGGAAGAATCAGTACCGTGGGATTAGGCAGCGCCCATGGGGCA
AATGGGCCGCTGAGATTCGTGATCCCAGGAAAGGCTCCCGAGAATGGCTTGGAACGTTTGACACAGCTGAGGAAGCAGCA
AGAGCCTACGATGCTGCAGCACGCAGAATCCGCGGTAGCAAAGCTAAGGTCAATTTCCCAGAGGCGAAGATCCCTAGCAT
CTCCCAGAAACGCCCTAGCGTTAGGACCAGTAATCTTCAGAAACCAGTTGCTAAACCAAACCAAAGCCCAACATTGGTTC
AGCAGCCAACATATCTGAGTCAGCAGTACTGCAACAACTCTTTTGACAACATGGGACATGAGTCTTTTGGTGATGTGAGT
TTCATGGAAGAGAAACCTCAGATGTACAACAATCAGTTTGGTGTAACAAACTCGTTTGATGCTGGAGGTAACAACGGATA
CCAGTACTTCAGCTCTGATCAGGGCAGTAACTCATTTGACTGCTCTGAGTTCGGGTGGAGTGATCACGGCCCCAAAACAC
CCGAGATCTCGTCAATGCTAGTCAATAATAACCAAGCTCCGTTCATTGAAGAAACCAATGCAGCCAAGAAGCTTAAACCT
AACGCCGAGGACAGGATGAACCACAATGATGAGTCTGATGATCTCATGGTATACCTTGACAACGCCTTATGGGACACTCC
ACTAGAAGTGGAAGCTATGCTTGGCCCAGATGCTGGTGCGGTGACTCAGGAAGAGGAAAACCCAATGGAACTGTGGAGCT
TAGATGATATCAGTTTCATGCTGGAAGGAGACCTTTGA