Details for Capsella Locus Carubv10013924m

Position : scaf_3 ( 5`- 5681032 .. 5683140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013924m

Protein [Map View]
MTRRCSHCSNNGHNSRTCPTRGGGGTCGGGGGGSCSSSAVKLFGVRLTDGSIIKKSASMGNLSALAVAAAAATHHRLSPS
SPLATSNHNDSPLSDHARYSSLHHNEGYLSDDPAHGSGSSHRRGERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNYV
TSRTPTQVASHAQKYFIRHTSSSRRKRRSSLFDMVTDEMVTDSSPTQEDQNVNRSSPSKEPENKSYLPSLELSLNNTMEP
EAVIATAPPQEKPEEAIEPSNGVSPMLVPGGFFPPCFPVTYTIWLPATSTSLQGTEHALEAETSSQQHQVLKPKPEFAKE
RVNMDELVGMSQLSIGMATKHETETSPSPSPLSLKLEPSRPSAFHSNGSVSGADLSKGNSAIQAI*

DNA
ATGACTCGTCGGTGTTCGCATTGTAGCAACAATGGACACAACTCACGCACGTGTCCTACGCGTGGTGGTGGTGGCACATG
CGGTGGAGGAGGGGGAGGGTCTTGCTCCTCCTCCGCCGTGAAGCTATTCGGCGTCAGGTTAACGGATGGGTCGATTATAA
AAAAGAGTGCGAGTATGGGTAATCTCTCGGCATTGGCTGTTGCGGCGGCGGCGGCGACGCACCACCGTTTATCTCCGTCG
TCTCCTTTAGCGACGTCTAATCATAACGATTCGCCGTTATCGGATCATGCGCGGTACTCTAGTTTGCATCATAACGAAGG
GTATCTATCTGATGATCCTGCTCATGGTTCTGGGTCTAGTCACCGTCGTGGAGAGAGGAAGCGAGGTGTTCCTTGGACTG
AGGAAGAACACAGACTATTCTTAGTCGGTCTTCAGAAACTTGGGAAAGGAGATTGGCGCGGTATTTCAAGAAACTATGTA
ACTTCAAGAACTCCTACACAAGTGGCTAGTCACGCTCAAAAGTATTTCATTCGCCATACGAGTTCCAGCCGCAGGAAAAG
ACGGTCTAGCCTCTTTGACATGGTTACAGATGAAATGGTTACCGATTCATCGCCAACACAAGAAGACCAAAACGTGAACC
GTTCTTCTCCAAGCAAGGAACCCGAGAACAAAAGTTACCTTCCTTCACTAGAGCTCTCACTCAATAATACAATGGAACCT
GAAGCGGTCATAGCCACGGCGCCACCACAGGAAAAACCTGAAGAAGCTATAGAACCATCGAACGGGGTTTCACCAATGCT
AGTCCCGGGAGGTTTCTTTCCTCCTTGCTTTCCAGTCACTTACACGATTTGGCTCCCTGCAACGTCCACATCACTCCAGG
GAACAGAACATGCTTTAGAAGCTGAGACTTCTTCTCAGCAGCATCAGGTCCTAAAACCAAAACCAGAATTTGCTAAAGAA
CGGGTGAACATGGACGAGCTGGTTGGTATGTCTCAGCTTAGCATAGGAATGGCGACAAAACATGAAACGGAAACTTCACC
TTCTCCTTCCCCGCTGTCATTGAAACTAGAGCCCTCAAGGCCATCGGCGTTTCACTCAAATGGCTCGGTTAGTGGTGCGG
ATTTGAGTAAAGGCAACAGCGCAATCCAGGCTATCTGA