Details for Capsella Locus Carubv10013906m

Position : scaf_3 ( 5`- 7816724 .. 7819086 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013906m

Protein [Map View]
MSHSNLVTPTLSLTVTLIPKHPIRQLSAPIPNRNFTNPRLLFPLRLNETPSCHAAKRVFVVRAKADGDGKTGNWVNRLPI
PGLGAENVFRLISSATGSPIGQFISSPVTFLHSVDPRIKLVWLLTLVVLPARANIVVRLGLVVCTALLSILVLPRQVWMD
QLARVSLLSGILFITLGLGSDGAPPMLQSRTPPSSVTGLPNLPMSLSGYSYMLLKLGPLQFTRKGLSVGSTAACLTFIIF
QSASICLATTTPEQLALALRWFLFPLTYIGVPVGEIILTLLLSLRFINLVFDEVRSVSLGIVSRRVNWQQLTVLETLDIF
ASFIRRIFKNIFRHAEQISQAMIVRGFRGESSSHKIYFFSGSSNKFADFASVLCLIGVISTALLSEYFLV*

DNA
ATGAGTCACTCCAATCTCGTAACTCCAACGCTATCGCTCACCGTAACCCTAATCCCCAAACACCCAATTCGTCAACTCTC
TGCCCCAATTCCTAACCGGAACTTCACAAACCCTAGGCTTCTCTTCCCGCTCAGGCTTAATGAGACTCCTTCCTGTCACG
CCGCGAAAAGGGTCTTCGTTGTTAGAGCCAAAGCCGACGGAGATGGTAAAACCGGTAACTGGGTCAACAGGTTACCGATT
CCAGGACTCGGAGCTGAAAATGTCTTCAGATTGATTTCGAGCGCGACGGGTAGCCCCATTGGCCAGTTCATATCGTCCCC
TGTTACATTTCTCCATTCGGTGGATCCTAGGATCAAATTGGTGTGGTTATTAACTCTAGTAGTTCTACCAGCAAGAGCAA
ATATAGTTGTGCGTTTGGGACTTGTTGTATGTACAGCTCTTTTGTCAATCCTTGTTCTCCCAAGACAAGTATGGATGGAT
CAATTGGCGAGAGTTTCACTTCTTTCGGGAATCCTATTCATAACCTTGGGGCTAGGTTCAGATGGTGCACCCCCAATGCT
TCAGTCAAGAACCCCACCATCTTCAGTCACAGGCTTGCCTAATCTTCCCATGTCTTTAAGCGGTTATTCGTACATGTTAC
TGAAGCTTGGACCTTTGCAATTCACAAGGAAAGGTTTATCTGTTGGAAGCACAGCCGCATGCTTAACCTTTATAATCTTT
CAAAGTGCTAGTATTTGCCTTGCAACCACAACACCTGAGCAACTTGCGCTAGCTCTACGTTGGTTCTTGTTCCCATTGAC
ATATATTGGTGTTCCAGTAGGTGAAATCATCCTCACACTCCTGCTTTCACTGAGATTCATCAATTTGGTTTTCGATGAGG
TCCGAAGTGTTTCGTTGGGAATTGTATCTCGAAGAGTAAACTGGCAGCAGCTTACTGTTCTGGAGACACTTGATATTTTC
GCATCGTTCATACGCCGCATCTTCAAGAATATATTTCGCCATGCCGAGCAAATATCACAGGCCATGATCGTTAGAGGCTT
CAGAGGAGAGAGCAGTAGCCACAAGATCTACTTCTTCTCGGGATCATCAAATAAATTTGCAGATTTTGCATCAGTCTTGT
GTTTAATCGGTGTAATCTCAACCGCGCTCCTGTCCGAATACTTTCTTGTCTAA