Details for Capsella Locus Carubv10013891m

Position : scaf_3 ( 5`- 5729720 .. 5731569 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013891m

Protein [Map View]
MGRAARWFKGIFGMKKSKEKESRVSRDGEAGGGSDIHRKVLQADSVWLRTYLAETDKEQNKHAIAVAAATAAAADAAVAA
AQAAVAVVRLTSNGRTGGYSGGNGVSGTTMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSM
QALIRAQTSVRSQRINRSITRDNNNNNNMFHPRHSLERFDDSRSEVHSKRISISVEKQSNYNNAYDETSPKIVEIDTYKT
KSRSKRMNVAVSECGDDFIYHGKDFEWSFPGDKCKFPTAQNTPRFSNNHHYYAPPSPAKSVSREACFRPSYPGLMTPSYM
ANTQSFKAKVRSHSAPRQRPDRKRLSLDEIMAARSSVSGVRMVQPQLQTQPQQRSPCSYDHQFLQDATNFRFYN*

DNA
ATGGGCAGAGCTGCGAGATGGTTCAAGGGTATTTTTGGTATGAAGAAGAGCAAAGAGAAAGAGAGCCGTGTTTCCCGTGA
CGGTGAAGCTGGTGGAGGGTCAGACATTCACCGGAAAGTTCTCCAAGCAGACTCTGTTTGGCTCAGAACTTACCTTGCGG
AAACAGACAAAGAACAGAACAAACACGCGATTGCGGTTGCTGCAGCCACAGCCGCAGCAGCAGACGCAGCGGTTGCAGCG
GCTCAGGCTGCCGTAGCGGTTGTGAGGCTAACAAGTAACGGAAGAACCGGAGGATATTCCGGCGGGAATGGGGTTTCCGG
GACCACAATGGAGCGGTGGGCCGCCGTGAAAATACAGTCAGTCTTCAAGGGTTACTTGGCGAGAAAAGCGTTAAGAGCTT
TGAAAGGTCTAGTGAAGCTACAAGCTTTGGTGAGAGGATACTTAGTCCGCAAACGCGCCGCCGAAACGCTTCATAGCATG
CAAGCTCTCATTAGAGCTCAAACTAGCGTTCGTTCTCAACGCATCAACCGCTCTATCACCAGAGACAACAACAACAACAA
CAACATGTTTCATCCTCGACACTCACTTGAGAGGTTTGACGATTCAAGAAGTGAAGTCCATAGCAAGAGGATATCAATCT
CTGTTGAGAAACAGAGTAATTACAACAATGCGTATGATGAGACCAGTCCCAAGATTGTGGAGATTGATACTTACAAGACG
AAATCAAGATCCAAGAGAATGAACGTGGCTGTATCTGAATGTGGAGATGATTTCATCTATCACGGCAAAGATTTCGAATG
GAGTTTCCCGGGAGACAAATGCAAGTTTCCCACTGCCCAAAACACGCCAAGATTCTCAAATAACCATCATTACTACGCAC
CGCCTTCGCCAGCCAAGAGCGTTTCCAGAGAGGCTTGTTTTAGGCCGAGTTATCCTGGTTTGATGACACCGAGCTATATG
GCTAATACGCAGTCGTTTAAGGCTAAGGTGCGTTCGCATAGTGCACCGAGACAACGTCCTGATCGGAAGAGATTGTCACT
CGATGAGATTATGGCGGCTAGGAGTAGTGTTAGCGGCGTGAGGATGGTACAACCACAACTGCAAACGCAACCACAGCAAC
GCTCTCCTTGTTCGTACGATCATCAGTTTCTTCAGGACGCTACGAATTTTAGATTCTATAATTAG