Details for Capsella Locus Carubv10013882m

Position : scaf_3 ( 5`- 2871305 .. 2873443 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013882m

Protein [Map View]
MEGEIARRSETTGLREVEESTTEVGIGGGDGDDDGAAGTSGRGGKDRVKGPWSPEEDVVLSKLVDTHGARNWSLIARSIP
GRSGKSCRLRWCNQLDPTVIRNSFTEVEDQAIITAHAIHGNKWAAIAKILPGRTDNAIKNHWNSTLRRRFMDLEKAKNMG
TAGLVVENPGFGVASSEETLSSGGGGQVTTPVVSPEGKEATSMEICEEQCVEKTNGEGISKQDGNDPPTLFHQGISKQDV
NDPPTLFRPVAQISSFNAYNHMEGSPSPHIQDQNQFQSSKQDAAMLRVLEGVYSELCVPQTCGGGCCTNNPVGIIQQDSL
LGPEFVDYLDPPTFPSYELAAITTDISSLAWLRSGLESSSVRAMEEAAVRLRPQGSRGHRDHYLVSEQGKNITNVLST*

DNA
ATGGAGGGAGAGATTGCGAGACGATCGGAGACGACGGGGTTAAGGGAGGTGGAAGAATCGACGACAGAGGTGGGAATTGG
CGGAGGAGATGGCGATGACGATGGTGCGGCAGGGACGAGTGGGAGAGGAGGAAAAGATCGAGTAAAAGGGCCGTGGTCAC
CAGAGGAAGATGTTGTGTTGAGTAAACTCGTTGATACTCATGGAGCCAGGAATTGGAGTCTGATCGCACGGAGTATTCCT
GGTCGTTCAGGCAAGTCTTGTCGTCTTCGTTGGTGTAATCAGCTCGATCCAACTGTTATACGCAACTCCTTTACTGAGGT
AGAAGACCAGGCTATCATCACAGCACATGCCATCCATGGAAACAAATGGGCTGCTATTGCAAAAATCCTTCCTGGTAGAA
CAGATAACGCTATTAAGAACCATTGGAACTCCACTCTAAGACGTCGATTTATGGATCTTGAAAAGGCAAAGAATATGGGA
ACTGCAGGCTTAGTCGTGGAAAATCCTGGATTTGGAGTAGCCTCGTCAGAAGAAACTTTATCCTCAGGGGGCGGTGGTCA
GGTAACTACTCCAGTTGTATCTCCAGAAGGCAAAGAGGCCACGTCCATGGAAATCTGTGAAGAGCAATGCGTTGAGAAAA
CAAATGGAGAAGGTATTTCTAAGCAAGACGGTAATGATCCTCCAACGCTTTTCCATCAAGGTATTTCTAAGCAAGACGTG
AATGATCCTCCTACGCTTTTCCGTCCGGTAGCTCAGATCAGTTCTTTTAATGCCTACAATCACATGGAAGGATCCCCCTC
CCCACATATACAAGACCAAAACCAGTTCCAATCATCTAAACAAGACGCTGCAATGTTAAGAGTGCTTGAAGGAGTTTACA
GCGAACTGTGTGTGCCTCAGACATGTGGAGGTGGTTGTTGCACAAACAATCCCGTTGGCATTATTCAGCAAGACTCATTG
TTGGGTCCAGAATTTGTGGATTACTTAGACCCACCAACGTTTCCAAGTTACGAACTAGCTGCTATAACAACGGATATAAG
CAGCCTTGCTTGGCTGAGAAGCGGTTTAGAGAGTAGCAGCGTGAGGGCGATGGAAGAAGCAGCTGTCCGGTTAAGGCCAC
AAGGCTCAAGGGGTCATCGAGATCACTATCTTGTCTCTGAACAGGGGAAGAACATAACCAATGTCTTGTCCACATAA