Details for Capsella Locus Carubv10013874m

Position : scaf_3 ( 5`- 810440 .. 814238 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013874m

Protein [Map View]
MDAIRKQLDVLMGANRNGDVQEVNRKYYDRDVCRLYLSGLCPHDLFQLTKMDMGPCPKLHSLQLRKEYQEARAKGVDNYD
RELEDAIDRLIVECDRKIGRALNRLQEEDAKAAIAISVSEVTQTPEILELSEKIKEKMKEADLHDLEGKMDLKIRALELV
EEMRIKRADQQAVLLLEAFNKDKASLPQPVPAQPPSSALPPPDPRTQEMINEKLKKAEDLGEQGMVDEAQKALEEAEALK
KLTVRREPAADSTKYSAVDVRITDQKLRLCDICGAFLSVYDSDRRLADHFGGKLHLGYMLVRDKLKELLDEKTNFRKERS
KERNSKERESSKDREKERGASSERRRDYDRRSRDRDRHHDRDREQDRDYDRSHSRRRRSRSRSRSRDRRDYDRHRRHNRY
*

DNA
ATGGATGCCATAAGGAAGCAGCTTGATGTGCTCATGGGAGCAAACCGGAACGGCGACGTTCAGGAGGTGAACCGCAAATA
CTATGACCGCGATGTGTGTCGTCTTTACTTGTCTGGTCTCTGCCCTCACGATCTCTTTCAGTTGACGAAAATGGATATGG
GACCTTGCCCAAAGTTGCACTCTTTGCAGCTTAGGAAAGAATATCAAGAAGCAAGGGCAAAAGGTGTTGATAACTACGAT
AGGGAATTGGAAGATGCCATAGACAGGCTCATTGTTGAGTGTGATAGGAAGATTGGTAGGGCCCTTAACCGTCTTCAAGA
AGAGGATGCCAAAGCTGCCATTGCCATTTCAGTCTCTGAAGTCACTCAGACACCTGAAATTCTCGAGTTATCAGAGAAAA
TCAAAGAGAAGATGAAGGAAGCAGATTTGCATGATCTTGAAGGCAAAATGGATCTTAAGATTAGAGCTCTTGAGTTAGTC
GAAGAGATGAGGATCAAGAGAGCTGACCAACAGGCAGTGCTGCTGTTGGAAGCCTTCAACAAAGATAAGGCATCATTACC
ACAACCCGTTCCAGCTCAACCACCATCTTCCGCATTGCCTCCACCGGATCCTCGCACTCAAGAAATGATAAATGAGAAAC
TGAAGAAGGCTGAAGATCTTGGTGAACAAGGAATGGTTGATGAAGCACAGAAAGCACTGGAAGAGGCTGAAGCTCTTAAG
AAGCTTACAGTTAGACGAGAACCAGCAGCAGATTCAACGAAGTACTCTGCTGTTGATGTGCGCATTACAGACCAAAAGTT
GCGTCTATGCGACATATGTGGAGCATTCTTGAGCGTCTATGACAGTGATCGTCGTTTAGCTGATCATTTTGGTGGGAAGC
TTCATTTAGGTTACATGCTAGTCCGGGACAAATTGAAAGAGCTTCTGGATGAGAAGACCAATTTCCGCAAGGAAAGGTCA
AAGGAAAGGAACAGTAAGGAGAGGGAATCAAGTAAAGACCGAGAGAAAGAGAGAGGAGCTAGTAGTGAACGTCGAAGAGA
TTATGATCGCAGGAGCAGAGATCGAGATAGGCACCATGACCGTGATCGTGAACAAGACAGAGACTATGATCGGTCACATT
CAAGAAGACGTAGGTCACGCTCACGGTCCAGGTCCAGAGACAGAAGGGACTATGATCGCCATAGGCGTCACAACCGCTAC
TAG