Details for Capsella Locus Carubv10013872m

Position : scaf_3 ( 5`- 8696876 .. 8700479 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013872m

Protein [Map View]
MEEIRNHGKESSFSNLVSKFPITGFPFFSPIYLSNPLFPNTEKKQTLKIERDQFVTMGSLKDDGQRRDMEEEEEESKEPL
LMAQNQRFTMFPVRYKPIWEMYKKAEASFWTAEEVDLSTDVQQWEALSDSEKHFISHVLAFFAASDGIVLENLAARFLND
VQVPEARAFYGFQIAMENIHSEMYSLLLETYIKDPKEKDRLFNAIETIPCISKKAQWCLDWIQSPMSFAVRLVAFACVEG
IFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEKIYQIVHEAVEIETEFVCKALPCDLI
GMNSNLMSQYIQFVADRLLVTLGCERRYKAENPFDWMEFISLQGKTNFFEKRVGEYQKASVMSNIENGSKNYEFTTEEDF
*

DNA
ATGGAAGAAATCAGGAACCACGGCAAAGAATCCAGCTTCAGCAACCTTGTCAGCAAGTTTCCTATCACAGGTTTTCCCTT
TTTTTCCCCTATCTATTTATCTAATCCTCTGTTTCCCAATACAGAGAAAAAACAAACCCTCAAAATTGAGAGAGACCAAT
TCGTGACAATGGGTTCGTTGAAGGACGATGGTCAAAGAAGAGACATGGAGGAAGAAGAAGAAGAGTCAAAAGAGCCGCTC
TTGATGGCGCAGAACCAGAGGTTCACTATGTTTCCCGTTAGGTACAAACCGATTTGGGAGATGTATAAGAAGGCTGAGGC
TAGTTTCTGGACTGCCGAAGAGGTTGATCTTTCCACGGATGTGCAACAATGGGAAGCCTTGTCTGATTCAGAGAAACATT
TTATTAGCCATGTTCTAGCGTTTTTCGCAGCATCAGATGGGATTGTTTTGGAGAATTTGGCTGCTAGATTCTTGAATGAT
GTCCAAGTTCCAGAGGCTCGCGCTTTCTATGGATTTCAAATCGCCATGGAGAACATTCATTCGGAGATGTACAGCTTACT
TCTGGAGACATATATTAAGGACCCAAAGGAGAAGGATAGATTGTTCAATGCTATTGAGACCATTCCTTGTATTTCCAAGA
AGGCACAATGGTGTTTAGATTGGATTCAAAGTCCTATGTCATTTGCTGTGAGGCTGGTTGCGTTTGCATGCGTGGAAGGA
ATATTCTTCTCAGGAAGCTTCTGTGCCATCTTCTGGCTTAAGAAGAGGGGTCTTATGCCGGGTTTGACATTCTCAAACGA
GCTTATATCGAGAGATGAGGGGCTCCACTGTGACTTTGCTTGTCTCTTGTACAGTTTGCTGCAGAAGCAGCTTCCATTGG
AGAAAATTTATCAGATTGTTCATGAGGCAGTGGAAATTGAGACAGAGTTTGTCTGCAAGGCTCTTCCATGTGATCTGATC
GGAATGAACTCGAACCTCATGAGTCAGTACATACAATTTGTCGCAGACCGTCTTCTGGTTACCTTGGGATGTGAAAGGAG
ATACAAAGCAGAAAATCCATTTGACTGGATGGAGTTCATATCTCTGCAAGGGAAGACAAACTTCTTTGAGAAGAGAGTGG
GAGAGTATCAGAAAGCATCGGTTATGTCGAACATCGAAAATGGAAGTAAGAACTACGAATTCACTACTGAAGAAGACTTT
TGA